IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. naojiro@kais.kyoto-u.ac.jp Mouse germinal vesicle (GV)-oocyte cDNA library. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. Figure 1 (B) naojiro@kais.kyoto-u.ac.jp Accepted 2006-JUN-9 by JYOTI. Mouse germinal vesicle (GV)-oocyte cDNA library. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. naojiro@kais.kyoto-u.ac.jp Mouse germinal vesicle (GV)-oocyte cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. naojiro@kais.kyoto-u.ac.jp Accepted 2006-JUN-9 by JYOTI. Mouse germinal vesicle (GV)-oocyte cDNA library. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. naojiro@kais.kyoto-u.ac.jp Mouse germinal vesicle (GV)-oocyte cDNA library. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. Bacterially expressed GST or GST fusion protein GST-Ras was purified and preloaded with either GTP or GDP. Figure 1 (A). Figure 6. naojiro@kais.kyoto-u.ac.jp Accepted 2006-JUN-9 by JYOTI. Mouse germinal vesicle (GV)-oocyte cDNA library. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. naojiro@kais.kyoto-u.ac.jp Mouse germinal vesicle (GV)-oocyte cDNA library. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. Figure 1 (B) naojiro@kais.kyoto-u.ac.jp Accepted 2006-JUN-9 by JYOTI. Mouse germinal vesicle (GV)-oocyte cDNA library. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Oog1, an oocyte-specific protein, interacts with Ras and Ras-signaling proteins during early embryogenesis. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. naojiro@kais.kyoto-u.ac.jp Mouse germinal vesicle (GV)-oocyte cDNA library. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Tsukamoto S., Ihara R., Aizawa A., Kishida S., Kikuchi A., Imai H., Minami N. Figure 2 (C) to (E) naojiro@kais.kyoto-u.ac.jp Accepted 2006-JUN-9 by JYOTI. Mouse germinal vesicle (GV)-oocyte cDNA library. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation q4fjp3_mouse Nras protein protein mouse Mus musculus Mouse MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVLMCKTL BEF9E0AEA88D33F6 gnds_mouse Ral guanine nucleotide dissociation stimulator Ralgds Rgds Ral guanine nucleotide exchange factor protein protein mouse Mus musculus Mouse MMVDCQSSTQEIGEELINGVIYSISLRKVQLHQGATKGQRWLGCENESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCILPYSSEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEDLEPSEAESEALSPAPVLSLKPASQLEPALLLTPSQVVTSTPVREPAAAPVPVLASSPVVAPAPELEPVPEPPQEPEPSLALAPELEPAVSQSLELESAPVPTPALEPSWSLPEATENGLTEKPHLLLFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLAPTIRATVAQFNNVANCVITTCLGDQSMKAPDRARVVEHWIEVARECRALKNFSSLYAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPRRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSIAPEEHFGTWFRAMERLSEAESYTLSCELEPPSESASNTLRSKKSTAIVKRWSDRQAPSTELSTSSSAHSKSCDQLRCSPYLGSGDITDALSVHSAGSSSSDVEEINMSFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVSTTRTHKRSVSGVCSYSSSLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKHNLDEDEPEDYELVQIISEDHKLKIPENANVFYAMNSTANYDFILKKRTFTKGAKVKHGASSTLPRMKQKGLRIAKGIF 5C6731F7BF3B07B8 oog1_mouse Oogenesin-1 Oog1 Oog protein protein mouse Mus musculus Mouse MVICLHCPDQDDSLEEVTEECYSPPTLQNLAIQSLLRDEALAISALTDLPQSLFPVIFEEAFTDGYIGILKAMIPVWPFPYLSLGKQINNCNLETLKAMLEGLDILLAQKVQTSRCKLRVINWREDDLKIWAGSHEGEGLPDFRTEKQPIENSAGCEVKKELKVTTEVLRMKGRLDESTTYLLQWAQQRKDSIHLFCRKLLIEGLTKASVIEIFKTVHADCIQELILRCICIEELAFLNPYLKLMKSLFTLTLDHIIGTFSLGDSEKLDEETIFSLISQLPTLHCLQKLYVNDVPFIKGNLKEYLRCLKKPLETLCISNCDLSQSDLDCLPYCLNICELKHLHISDIYLCDLLLEPLGFLLERVGDTLKTLELDSCCIVDFQFSALLPALSQCSHLREVTFYDNDVSLPFLKQLLHHTALLSQLIYECYPAPLECYDDSGVILTHRLESFCPELLDILRAKRQLHSVSFQTTKCSKCGGCYIYDRHTQCCRFVELL D80F528860AAF196 oog1-raldgs 2 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association oog1-raldgs-1 3 8 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction oog1-raldgs-2 1 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait physical association physical association raldgs-oog1 4 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association oog1-raldgs-3 5 7 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region enhanced green flourescent protein gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Interaction of Oog1 and Ralgds was colocalised to the nucleus. Interaction of Oog1 and Ralgds sequestered Ralgds to the nucleus. oog1-ras 3 8 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Oog1 specifically interacts with Ras in a GTP-dependent manner.