MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro peptide array peptide array elisa enzyme linked immunosorbent assay ELISA ELISA elisa Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions human-brain Homo sapiens brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. Fibrillar aggregates was monitored by filter retardation assay, PP treatment removes the GST tag from the fusion protein and thereby stimulates the assembly of insoluble Atx71Q(242 360) protein aggregates. The assembly of SDS stable Atx 3 protein aggregates was monitored by filtration using an anti-Atx (CT1) antibody. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro competition binding competition binding anti tag western anti tag western blot anti tag western Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. An arginine/lysine-rich motif is crucial for VCP/p97-mediated modulation of ataxin-3 fibrillogenesis. EMBO J. (0261-4189) 2006 imex curation Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de 16-Dec-2008: Contacted by JYOTI. orchard Only protein-protein interactions human-brain Homo sapiens brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Boeddrich A., Gaumer S., Haacke A., Tzvetkov N., Albrecht M., Evert BO., Muller EC., Lurz R., Breuer P., Schugardt N., Plassmann S., Xu K., Warrick JM., Suopanki J., Wullner U., Frank R., Hartl UF., Bonini NM., Wanker EE. Immunohistochemical studies of brain sections were prepared from SCA3 patients. The organism of origin for the protein ATX-3 has been determined from the backreference PMID:9580663. Proteins eluted from the affinity matrix were analysed by SDS�PAGE and Coomassie blue staining followed by mass spectrometry. ewanker@mdc-berlin.de Accepted 2008-JUL-30 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. EMBO J. (0261-4189) 2006 orchard Only protein-protein interactions imex curation p54252-1 Ataxin-3 ATXN3 ATX3 MJD MJD1 SCA3 Machado-Joseph disease protein 1 Spinocerebellar ataxia type 3 protein MJD1a protein protein human Homo sapiens Human MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGKACSPFIMFATFTLYLTYELHVIFALHYSSFPL Variant in position: 349:YELHVIFALHYSSFPL->Missing (in short isoform 1, due to a stop-gain single nucleotide polymorphism, has reduced half-life due to increased proteasomal degradation, has reduced solubility and increased tendency to form aggregates, increased localization to the nucleus). 4B2477EB67C30EFF atx3_mouse Ataxin-3 Atxn3 Mjd Machado-Joseph disease protein 1 homolog protein protein mouse Mus musculus Mouse MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIKVQQMHRPKLIGEELAHLKEQSALKADLERVLEAADGSGIFDEDEDDLQRALAISRQEIDMEDEEADLRRAIQLSMQGSSRSMCENSPQTSSPDLSSEELRRRREAYFEKQQQQQQEVDRPGPLSYPRERPTTSSGGRRSDQGGDAVSEEDMLRAAVTMSLETAKDNLKAERKK D148DD10EA481D5B ubb_human Polyubiquitin-B UBB protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC 33011162F1C48BB1 adenosine 5'-[gamma-thio]triphosphate Adenosine 5'-[gamma-thio]triphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ube4b_human Ubiquitin conjugation factor E4 B UBE4B HDNB1 KIAA0684 UFD2 Ubiquitin fusion degradation protein 2 Homozygously deleted in neuroblastoma 1 RING-type E3 ubiquitin transferase E4 B protein protein human Homo sapiens Human MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNMTPATSPIGASGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQVDVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPDRNLLLNTGSNPGTSPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQLAVPSTPLSPHSAASGTAAGSQPSSPRYRPYTVTHPWASSGVSILSSSPSPPALASSPQAVPASSSRQRPSSTGPPLPPASPSATSRRPSSLRISPSLGASGGASNWDSYSDHFTIETCKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPRSLQQPSFLVPYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLDSDYFKYPLMALGELCETKFGKTHPVCNLVASLRLWLPKSLSPGCGRELQRLSYLGAFFSFSVFAEDDVKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALSYMAAVVNANMKKAQMQTDDRLVSTDGFMLNFLWVLQQLSTKIKLETVDPTYIFHPRCRITLPNDETRVNATMEDVNDWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRRLRAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFLRRCLNFYGLLIQLLLRILDPAYPDITLPLNSDVPKVFAALPEFYVEDVAEFLFFIVQYSPQALYEPCTQDIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPAVQPRTQKFFEMIENHPLSTKLLVPSLMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSGKQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPRDQQQARQSQLAQDERVSRSYLALATETVDMFHILTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVENPEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTIAIEKFKLLAEKVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNSDH 6BAA80984B03E43B atx3_human Ataxin-3 ATXN3 ATX3 MJD MJD1 SCA3 Machado-Joseph disease protein 1 Spinocerebellar ataxia type 3 protein protein protein human Homo sapiens Human MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLERVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEELRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLETVRNDLKTEGKK 90C3EF73BB26CAFD tera_mouse Transitional endoplasmic reticulum ATPase Vcp 15S Mg(2+)-ATPase p97 subunit Valosin-containing protein protein protein mouse Mus musculus Mouse MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG DIP protein Q01853 original sequence version: 84 DIP protein Q01853 original sequence version: 112 DIP protein Q01853 original sequence version: 152 DIP protein Q01853 original sequence version: 136 DIP protein Q01853 original sequence version: 156 DIP protein Q01853 original sequence version: 149 501B721D3A77BA8A tera_human Transitional endoplasmic reticulum ATPase VCP 15S Mg(2+)-ATPase p97 subunit Valosin-containing protein protein protein human Homo sapiens Human MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG DIP protein P55072 original sequence version: 89 DIP protein P55072 original sequence version: 114 DIP protein P55072 original sequence version: 123 DIP protein P55072 original sequence version: 150 DIP protein P55072 original sequence version: 174 DIP protein P55072 original sequence version: 175 DIP protein P55072 original sequence version: 176 DIP protein P55072 original sequence version: 160 DIP protein P55072 original sequence version: 128 DIP protein P55072 original sequence version: 132 501B721D3A77BA8A adp adenosine 5'-(trihydrogen diphosphate) (ADP) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ufd1_rat Ubiquitin recognition factor in ER-associated degradation protein 1 Ufd1 Ubiquitin fusion degradation protein 1 homolog Ufd1l protein protein rat Rattus norvegicus (Rat) Rat MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPMVKKVEEDEAGGRFVAFSGEGQSLRKKGRKP C482D6B1B910494D atx-vcp 1 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1784516]The shifted ranges (2-348) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-1784516]2-360 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey human-brain Homo sapiens brain brain Brain [cerebrum] physical association physical association 1A, 1B VCP was selectively enriched from brain extract by Atx-3 atx-vcp-1 4 18 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait P54252-1:p.[Arg282His;Lys283Asn;Arg284His;Arg285His] arg282his lys283asn arg284his arg285his mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R H certain certain sequence position certain certain certain sequence position certain R H certain certain sequence position certain certain certain sequence position certain K N certain certain sequence position certain certain certain sequence position certain R H Fri Jul 22 11:08:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg282his,arg284his,lys283asn,arg285his' Wed May 02 16:57:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg282his,lys283asn,arg284his,arg285his' Tue Jun 30 17:42:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg282His;Lys283Asn;Arg284His;Arg285His]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 70gln expansion binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1784650]It was impossible to shift the feature ranges when the protein sequence has been updated. [EBI-1784650]296-317 43 gln expansion binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1784654]It was impossible to shift the feature ranges when the protein sequence has been updated. [EBI-1784654]296-317 ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C, 3A, 3E, 3F, 4D, S1 when purified His-tagged VCP fusion protein was incubated with Atx-3 affinity matrices, indicating that VCP and Atx-3 interact directly with each other in vitro (Figure 1C) SCA3 patients have an internal CAG repeat expansion to give 70 gln residues. The origins of the ATX43Q is however not known. We found that His-VCP interacts with GST-Atx71Q(257 360), but not with the mutant protein GST-Atx71Q(257 360)282HNHH in vitro atx-vcp-2 1 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1784549]The shifted ranges (2-348) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-1784549]2-360 70gln expansion binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1784554]It was impossible to shift the feature ranges when the protein sequence has been updated. [EBI-1784554]296-317 ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey human-brain Homo sapiens brain brain Brain [cerebrum] physical association physical association 1A, 1B VCP was selectively enriched from brain extract by Atx-3 SCA3 patients have an internal CAG repeat expansion to give 70 gln residues. vcp-ufd1 5 20 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1D In contrast, the well-characterized binding partner Ufd1 (Meyer et al, 2000) associated with VCP in the in vitro binding assay (Figure 1D). vcp-atx 3 18 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait P54252:p.Gln296[67] q70 poly-glutamine extension mutation increasing strength mutation increasing interaction strength mutation increasing strength range range range range QQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed Jun 13 18:40:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.gln296[67]' Tue Jun 30 17:31:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln296[67]' Authors have used a Q22 ATXN3 construct as WT reference. The reference sequence from UniProt has only 13 Qs in the poly-Q stretch. physical association physical association 2A P54252; P55072 transfection Cell extracts were prepared from transiently transfected COS-1 cells and treated with antisera raised against Atx-3 or Htt. VCP was selectively precipitated by an anti-Atx-3 The insertion of Gln residues due to CAG repeat expansion in SCA3 patients results in three fold increased binding to VCP. atx3-vcp 6 12 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 2C VCP was co-immunoprecipitated from mouse and human brain extracts using an anti-Atx-3 antibody atx3-vcp-1 7 18 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 2C VCP was co-immunoprecipitated from mouse and human brain extracts using an anti-Atx-3 antibody atx3-vcp-2 10 13 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component colocalization colocalization 2D Immunohistochemical studies of brain sections prepared from SCA3 patients revealed that Atx-3, VCP and ubiquitin colocalize in neuronal nuclear inclusions The colocalisation was observed in neurons. atx-vcp-3 4 14 unspecified role unspecified role ancillary ancillary 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 70gln expansion binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1784786]It was impossible to shift the feature ranges when the protein sequence has been updated. [EBI-1784786]296-317 ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A, 3B the GST-Atx22Q affinity matrix pulled down VCP from brain extracts in the presence and absence (apyrase treatment) of ATP. Moreover, the interaction was detected when the nonhydrolyzable ATP analog ATPgammaS was added to the binding reaction. In contrast, in the presence of ADP, VCP was not pulled down from the brain extract, suggesting that the addition of ADP changes the conformation of VCP and reduces the binding affinity for Atx-3. Similar results were obtained with reticulocyte lysate or when purified His-tagged VCP was used for in vitro binding assays ( atx-vcp-4 4 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 70gln expansion binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-2024140]It was impossible to shift the feature ranges when the protein sequence has been updated. [EBI-2024140]296-317 ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role ancillary ancillary direct interaction direct interaction 3A, 3B the GST-Atx22Q affinity matrix pulled down VCP from brain extracts in the presence and absence (apyrase treatment) of ATP. Moreover, the interaction was detected when the nonhydrolyzable ATP analog ATPgammaS was added to the binding reaction. In contrast, in the presence of ADP, VCP was not pulled down from the brain extract, suggesting that the addition of ADP changes the conformation of VCP and reduces the binding affinity for Atx-3. Similar results were obtained with reticulocyte lysate or when purified His-tagged VCP was used for in vitro binding assays ( Full length ATX-3 protein did not bind VCP in the presence of ADP. atp-vcp-atx3 4 14 unspecified role unspecified role ancillary ancillary 18 unspecified role unspecified role prey prey human-brain Homo sapiens brain brain Brain [cerebrum] 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A GST-Atx22Q affinity matrix pulled down VCP from brain extracts in the presence and absence (apyrase treatment) of ATP. Moreover, the interaction was detected when the nonhydrolyzable ATP analog ATPgammaS was added to the binding reaction. Interaction is also observed in the presence of non-hydrolysable ATP gamma S. atp-vcp-atx3-1 4 14 unspecified role unspecified role ancillary ancillary 18 unspecified role unspecified role prey prey in vitro In vitro 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A GST-Atx22Q affinity matrix pulled down VCP from brain extracts in the presence and absence (apyrase treatment) of ATP. Moreover, the interaction was detected when the nonhydrolyzable ATP analog ATPgammaS was added to the binding reaction. Interaction observed in the presence of non-hydrolysable ATP gamma S as well. atx-vcp-5 5 11 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 3C, 3D N-terminal VCP fragment (aa 1 199) is critical for the Atx-3 interaction, while the C-terminus containing the highly conserved ATP-binding domains D1 and D2 is not required. vcp-atx3 2 11 unspecified role unspecified role bait bait undefined mutation Arg cannot be replaced by any other of the 20 genetically coded amino acids mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:01 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'arg285' undefined mutation Arg cannot be replaced by any other of the 20 genetically coded amino acids mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:01 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'arg282' undefined mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:03 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'leu 281' undefined mutation Can be replaced by Arg and Trp only mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:04 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'lys283' undefined mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:02 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'arg284' undefined mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:11 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr288' undefined mutation mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:09 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'phe289' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 18 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 4A, 4C Figure 4A shows that binding peptide 43 (BP43; TSEELRKRREAYFEK, aa 277 291) interacted most strongly with the His VCP protein, suggesting that it contains the amino acids crucial for the association with His-VCP. comprehensive replacement analysis with 300 synthetic peptide analogs derived from the BP43 sequence by single amino-acid substitutions was performed (Figure 4C). Data analysis revealed that amino acids R282 and R285 are essential, and that the amino acids L281, K283, R284, Y288 and F289 are critical for the interaction with VCP. atxn3-vcp-1 9 18 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1784919]The shifted ranges (2-348) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-1784919]2-360 ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B, 4F To test whether BP43 can specifically inhibit the VCP�Atx-3 interaction, competition assays were performed (Figure 4B). Indeed, the addition of soluble BP43 to binding reactions completely abolished the interaction between His-VCP and GST-Atx22Q (Figure 4B, lane 3) vcp-atx3-2 9 15 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 18 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1784964]The shifted ranges (2-348) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-1784964]2-360 ecoli Escherichia coli (strain K12) direct interaction direct interaction 4F Competition assays with the peptides BP-E4B (SADEIRRRRLARLAG, aa 5�19) and BP43 (Figure 4A) were performed and the association between VCP and E4B was analyzed by immunoblotting (IB). As shown in Figure 4F, both peptides prevented the interaction between E4B and VCP in vitro atx3-vcp-3 8 16 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind range range range range P54252:p.Gln296[68] q71 poly-glutamine extension mutation mutation range range range range QQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed Jun 13 17:36:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.gln296[68]' Tue Jun 30 19:32:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln296[68]' P54252:p.[Arg282_Arg285delinsHisAsnHisHis;Gln296[65]] q68 poly-glutamine extension,arg_lys_arg_arg282-285his_asn_his_his mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RKRR HNHH range range range range QQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Original feature short label was q68 poly-glutamine extension,arg_lys_arg_arg282-285his_asn_his_his. Tue Jun 30 18:03:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg282_Arg285delinsHisAsnHisHis;Gln296[65]]' n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind range range range range P54252:p.Gln296[68] q71 poly-glutamine extension mutation mutation range range range range QQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Wed Jun 13 19:05:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.gln296[68]' Tue Jun 30 17:22:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln296[68]' P54252:p.[Arg282_Arg285delinsHisAsnHisHis;Gln296[65]] q68 poly-glutamine extension,arg_lys_arg_arg282-285his_asn_his_his mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RKRR HNHH range range range range QQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ Original short label was q68 poly-glutamine extension,arg_lys_arg_arg282-285his_asn_his_his. Tue Jun 30 17:53:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg282_Arg285delinsHisAsnHisHis;Gln296[65]]' n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 127 122 128 123 physical association physical association Protein aggregation has been measured here. The term physical interaction has been used in the absence of a better term. 5 VCP significantly enhanced the formation of SDS-insoluble protein aggregates in comparison to the control protein ovalbumin. Interestingly, the assembly of protein aggregates was significantly reduced when the protein GST-Atx68Q(242 360)282HNHH, which does not contain a functional VBM, was incubated with VCP and PP (Figure 5A).