MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Bex1, a novel interactor of the p75 neurotrophin receptor, links neurotrophin signaling to the cell cycle. Bex1, a novel interactor of the p75 neurotrophin receptor, links neurotrophin signaling to the cell cycle. EMBO J. (0261-4189) 2006 imex curation Vilar M., Murillo-Carretero M., Mira H., Magnusson K., Besset V., Ibáñez CF. 2009-01-08 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Vilar M., Murillo-Carretero M., Mira H., Magnusson K., Besset V., Ibáñez CF. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Bex1, a novel interactor of the p75 neurotrophin receptor, links neurotrophin signaling to the cell cycle. Bex1, a novel interactor of the p75 neurotrophin receptor, links neurotrophin signaling to the cell cycle. EMBO J. (0261-4189) 2006 imex curation Vilar M., Murillo-Carretero M., Mira H., Magnusson K., Besset V., Ibáñez CF. 2009-01-08 Only protein-protein interactions rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Vilar M., Murillo-Carretero M., Mira H., Magnusson K., Besset V., Ibáñez CF. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Bex1, a novel interactor of the p75 neurotrophin receptor, links neurotrophin signaling to the cell cycle. Bex1, a novel interactor of the p75 neurotrophin receptor, links neurotrophin signaling to the cell cycle. EMBO J. (0261-4189) 2006 imex curation Vilar M., Murillo-Carretero M., Mira H., Magnusson K., Besset V., Ibáñez CF. 2009-01-08 Only protein-protein interactions in vitro In vitro t7 phage t7 phage display t7 phage nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Vilar M., Murillo-Carretero M., Mira H., Magnusson K., Besset V., Ibáñez CF. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation tnr16_rat Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein rat Rattus norvegicus (Rat) Rat MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEETGHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV DIP protein P07174 original sequence version: 124 DIP protein P07174 original sequence version: 106 B2E152D94D3827F8 bex1_rat Protein BEX1 Bex1 Brain-expressed X-linked protein 1 homolog EG2RVC protein protein rat Rattus norvegicus (Rat) Rat MESKDQGAKNLNMENDHQKKEEKEEKPQDTIKREPVVAPTFEAGKNCAPRGGRRRFRVRQPIAHYRWDLMHRVGEPQGRMREENVQRFGEDMRQLMEKLRERQLSHSLRAVSTDPPHHDHHDEFCLMP mint Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states 13F8CCF5021C9D49 ngfr-bex1 2 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1E EMBO-Journal Using anti-Bex1 antibodies, endogenous Bex1 could be specifically co-immunoprecipitated with endogenous p75NTR in parental PC12 cells (Figure 1E), indicating that the two proteins are able to interact when expressed at physiological levels. mint ngfr-bex1-1 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1D EMBO-Journal Flag-tagged Bex1 (Flag-Bex1) could also be co-immunoprecipitated with endogenous p75NTR in two PC12 cell clones termed E2 and C4 generated by stable transfection (Figure 1C and D). mint ngfr-bex1-2 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified biotin tagged biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain intracellular domain range MINT-2789295: original sequence: 274-425 : KRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSP Stoichiometry: 1.0 physical association physical association F1A EMBO-Journal A C-terminal fragment of the rat ortholog of a human protein originally named Bex1 (Brown and Kay, 1999) was isolated in a T7 phage display screen for interacting partners of the intracellular domain of p75NTR (Figure 1A). mint bex1-ngfr 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain intracellular domain range MINT-2789300: original sequence: 274-425 : KRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSP Stoichiometry: 1.0 physical association physical association F1B EMBO-Journal p75NTR could be specifically co-immunoprecipitated with hemagglutinin (HA)-tagged Bex1 in transfected HEK293 T (293) cells (Figure 1B). mint