IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The methyl-CpG binding protein MBD1 is required for PML-RARalpha function. The methyl-CpG binding protein MBD1 is required for PML-RARalpha function. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Villa R., Morey L., Raker VA., Buschbeck M., Gutierrez A., De Santis F., Corsaro M., Varas F., Bossi D., Minucci S., Pelicci PG., Di Croce L. Antibodies were coupled to Protein A sepharose. 2 luciano.dicroce@crg.es Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Villa R., Morey L., Raker VA., Buschbeck M., Gutierrez A., De Santis F., Corsaro M., Varas F., Bossi D., Minucci S., Pelicci PG., Di Croce L. Antibodies were coupled to Protein A sepharose. 2 luciano.dicroce@crg.es Annotation to indicate that this entry has been checked and accepted by a senior curator. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 Only protein-protein interactions imex curation The methyl-CpG binding protein MBD1 is required for PML-RARalpha function. The methyl-CpG binding protein MBD1 is required for PML-RARalpha function. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Villa R., Morey L., Raker VA., Buschbeck M., Gutierrez A., De Santis F., Corsaro M., Varas F., Bossi D., Minucci S., Pelicci PG., Di Croce L. Antibodies were coupled to Protein A sepharose. 2 luciano.dicroce@crg.es Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Villa R., Morey L., Raker VA., Buschbeck M., Gutierrez A., De Santis F., Corsaro M., Varas F., Bossi D., Minucci S., Pelicci PG., Di Croce L. Antibodies were coupled to Protein A sepharose. 2 luciano.dicroce@crg.es Annotation to indicate that this entry has been checked and accepted by a senior curator. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 Only protein-protein interactions imex curation The methyl-CpG binding protein MBD1 is required for PML-RARalpha function. The methyl-CpG binding protein MBD1 is required for PML-RARalpha function. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 imex curation Villa R., Morey L., Raker VA., Buschbeck M., Gutierrez A., De Santis F., Corsaro M., Varas F., Bossi D., Minucci S., Pelicci PG., Di Croce L. Antibodies were coupled to Protein A sepharose. 2 luciano.dicroce@crg.es Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Villa R., Morey L., Raker VA., Buschbeck M., Gutierrez A., De Santis F., Corsaro M., Varas F., Bossi D., Minucci S., Pelicci PG., Di Croce L. Antibodies were coupled to Protein A sepharose. 2 luciano.dicroce@crg.es Annotation to indicate that this entry has been checked and accepted by a senior curator. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 Only protein-protein interactions imex curation all-trans-retinoic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mbd1_human Methyl-CpG-binding domain protein 1 CXXC3 Methyl-CpG-binding protein MBD1 Protein containing methyl-CpG-binding domain 1 CXXC-type zinc finger protein 3 MBD1 PCM1 protein protein human Homo sapiens Human MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPKAHPVAVASKKRKKPSRPAKTRKRQVGPQSGEVRKEAPRDETKADTDTAPASFPAPGCCENCGISFSGDGTQRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGECAACQVTEDCGACSTCLLQLPHDVASGLFCKCERRRCLRIVERSRGCGVCRGCQTQEDCGHCPICLRPPRPGLRRQWKCVQRRCLRGKHARRKGGCDSKMAARRRPGAQPLPPPPPSQSPEPTEPHPRALAPSPPAEFIYYCVDEDELQPYTNRRQNRKCGACAACLRRMDCGRCDFCCDKPKFGGSNQKRQKCRWRQCLQFAMKRLLPSVWSESEDGAGSPPPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ 665732782CC6A32A q15156_human PML-RAR protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP 8C16B6E85CBDD214 rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP DIP protein P10276 original sequence version: 190 DIP protein P10276 original sequence version: 118 DIP protein P10276 original sequence version: 162 DIP protein P10276-1 original sequence version: 143 DIP protein P10276 original sequence version: 200 DIP protein P10276-1 original sequence version: 152 E8D1CF9A1E57CB99 hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 pml_rar-hdac3 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hdac3-mbd1 3 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Integrity of the TRD domain was necessary for the interaction as R22A-I527R mutant showed a decrease in this interaction. I527 however could not be mapped to the UniProt entry. pml_rar-mbd1 1 6 unspecified role unspecified role bait bait c terminal binding region binding-associated region binding region c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey Q9UIS9:p.Asp32Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:10:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp32ala' Tue Jun 30 18:50:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp32Ala' physical association physical association Q15156; Q9UIS9 transfection anti-PML PGM3 This interaction persist in the presence of EtBr and is hence DNA independent. pml_rar-mbd1-1 1 6 unspecified role unspecified role bait bait c terminal binding region binding-associated region binding region range range range range 5 unspecified role unspecified role prey prey physical association physical association Q15156; Q9UIS9 transfection anti-PML PGM3 Retinoic acid inhibits this interaction. CHEBI:15367 rar-mbd1 1 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association rar-mbd1-1 1 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait physical association physical association hdac3-mbd1-1 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association pml_rar-mbd1-2 1 6 unspecified role unspecified role bait bait c terminal binding region binding-associated region binding region range range range range 4 inhibitor inhibitor prey prey 5 unspecified role unspecified role prey prey association association Q15156; Q9UIS9 transfection anti-PML PGM3