IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis. AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis. Plant Mol. Biol. (0167-4412) 2006 imex curation Song CP., Galbraith DW. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid galbraith@arizona.edu Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Song CP., Galbraith DW. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid galbraith@arizona.edu Accepted 2006-JUL-25 by JYOTI. Plant Mol. Biol. (0167-4412) 2006 Only protein-protein interactions imex curation AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis. AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis. Plant Mol. Biol. (0167-4412) 2006 imex curation Song CP., Galbraith DW. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid galbraith@arizona.edu Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Song CP., Galbraith DW. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid galbraith@arizona.edu Accepted 2006-JUL-25 by JYOTI. Plant Mol. Biol. (0167-4412) 2006 Only protein-protein interactions imex curation AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis. AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis. Plant Mol. Biol. (0167-4412) 2006 imex curation Song CP., Galbraith DW. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid galbraith@arizona.edu Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Song CP., Galbraith DW. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid galbraith@arizona.edu Accepted 2006-JUL-25 by JYOTI. Plant Mol. Biol. (0167-4412) 2006 Only protein-protein interactions imex curation hda19_arath Histone deacetylase 19 HDA19 At4g38130 F20D10.250 HD1 HDA1 RPD3A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTGGNSLASGPDGVKRKVCYFYDPEVGNYYYGQGHPMKPHRIRMTHALLAHYGLLQHMQVLKPFPARDRDLCRFHADDYVSFLRSITPETQQDQIRQLKRFNVGEDCPVFDGLYSFCQTYAGGSVGGSVKLNHGLCDIAINWAGGLHHAKKCEASGFCYVNDIVLAILELLKQHERVLYVDIDIHHGDGVEEAFYATDRVMTVSFHKFGDYFPGTGHIQDIGYGSGKYYSLNVPLDDGIDDESYHLLFKPIMGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVKFMRSFNVPLLLLGGGGYTIRNVARCWCYETGVALGVEVEDKMPEHEYYEYFGPDYTLHVAPSNMENKNSRQMLEEIRNDLLHNLSKLQHAPSVPFQERPPDTETPEVDEDQEDGDKRWDPDSDMDVDDDRKPIPSRVKREAVEPDTKDKDGLKGIMERGKGCEVEVDESGSTKVTGVNPVGVEEASVKMEEEGTNKGGAEQAFPPKT DIP protein O22446 original sequence version: 96 857D2E3D16B7CC1F erf82_arath Ethylene-responsive transcription factor 3 At1g50640 F17J6.16 F11F12.4 ERF3 ERF-3 Ethylene-responsive element-binding factor 3 ERF082 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRRGRGSSAVAGPTVVAAINGSVKEIRFRGVRKRPWGRFAAEIRDPWKKARVWLGTFDSAEEAARAYDSAARNLRGPKAKTNFPIDSSSPPPPNLRFNQIRNQNQNQVDPFMDHRLFTDHQQQFPIVNRPTSSSMSSTVESFSGPRPTTMKPATTKRYPRTPPVVPEDCHSDCDSSSSVIDDDDDIASSSRRRNPPFQFDLNFPPLDCVDLFNGADDLHCTDLRL C709BEABF306776B erf78_arath Ethylene-responsive transcription factor 4 ERF4 ERF-4 ERF078 At3g15210 K7L4.1 Ethylene-responsive element-binding factor 4 Protein RELATED TO APETALA2 5 RAP2-5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKMGLKPDPATTNQTHNNAKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEAARAYDTAARDFRGAKAKTNFPTFLELSDQKVPTGFARSPSQSSTLDCASPPTLVVPSATAGNVPPQLELSLGGGGGGSCYQIPMSRPVYFLDLMGIGNVGRGQPPPVTSAFRSPVVHVATKMACGAQSDSDSSSVVDFEGGMEKRSQLLDLDLNLPPPSEQA CEF16ABA5ACFB073 sap18_arath Histone deacetylase complex subunit SAP18 At2g45640 F17K2.17 18 kDa Sin3-associated polypeptide protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEAARRQGGGRPLPPPPRGVNQQPPRPKPEPVDREKTCPLLLRVFTKSGGHHTSEDYAVRGKEPKDEVQIYTWKDASLRELTDLVKEVSVAARRRNARLSFAFVYPNNKGGYNVREVGETMAYPNRKQPDDSKTLSELPFEIGDYLDVAIY 0F2ECE3C77234B6B sap18-hda19 3 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Figure 3A sap18-hda19-1 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey region n6btnlys N6-biotinyl-L-lysine (2S)-2-amino-6-(5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoylamino)hexanoic acid (3aS-(3aalpha,4beta,6aalpha))-N6-(5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)-L-lysine MOD_RES N6-biotinyllysine N6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]-L-lysine N6-biotinyl-L-lysine N6-biotinyllysine biocytin epsilon-N-biotinyllysine Biotin Biotinylation N6BtnLys biotinyl lysyl undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3B AtSAP18 and HDA19 specifically interact in vitro. sap18-erf3 3 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Figure 4A sap18-erf4 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Figure 4B sap18-erf4-1 2 6 unspecified role unspecified role prey prey region n6btnlys N6-biotinyl-L-lysine (2S)-2-amino-6-(5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoylamino)hexanoic acid (3aS-(3aalpha,4beta,6aalpha))-N6-(5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)-L-lysine MOD_RES N6-biotinyllysine N6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]-L-lysine N6-biotinyl-L-lysine N6-biotinyllysine biocytin epsilon-N-biotinyllysine Biotin Biotinylation N6BtnLys biotinyl lysyl undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association Figure 4C AtSAP18 and ERF3 or ERF4 specifically interact in vitro. sap18-erf3-1 2 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association Figure 4C Binding reactions between immobilized AtSAP18 and ERF3 or ERF4 by GST pull-down assays. sap18-erf3-2 1 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component association association Figure 5 C Electrophoretic mobility shifts indicate specific interaction of a complex with the GCC box. ERF3 O80339 protein was bound to a 16 base pair GCC box DNA oligonucleotide. sap18-erf3-3 1 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Figure 5 B Electrophoretic mobility shifts indicate specific interaction of a complex with the GCC box. ERF3 O80339 protein was bound to a 16 base pair GCC box DNA oligonucleotide.