MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A WNK kinase binds and phosphorylates V-ATPase subunit C. A WNK kinase binds and phosphorylates V-ATPase subunit C. FEBS Lett. (0014-5793) 2006 imex curation Hong-Hermesdorf A., Brüx A., Grüber A., Grüber G., Schumacher K. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hong-Hermesdorf A., Brüx A., Grüber A., Grüber G., Schumacher K. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation A WNK kinase binds and phosphorylates V-ATPase subunit C. A WNK kinase binds and phosphorylates V-ATPase subunit C. FEBS Lett. (0014-5793) 2006 imex curation Hong-Hermesdorf A., Brüx A., Grüber A., Grüber G., Schumacher K. 2009-01-08 Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hong-Hermesdorf A., Brüx A., Grüber A., Grüber G., Schumacher K. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation A WNK kinase binds and phosphorylates V-ATPase subunit C. A WNK kinase binds and phosphorylates V-ATPase subunit C. FEBS Lett. (0014-5793) 2006 imex curation Hong-Hermesdorf A., Brüx A., Grüber A., Grüber G., Schumacher K. 2009-01-08 Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Hong-Hermesdorf A., Brüx A., Grüber A., Grüber G., Schumacher K. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation vatc_arath V-type proton ATPase subunit C VHA-C DET3 F13K23.9 At1g12840 Vacuolar proton pump subunit C VATC Vacuolar H(+)-ATPase subunit C protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSRYWVVSLPVKDSASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDDLLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPLKEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIVESEHLVTLLAVVPKYSQKDWLACYETLTDYVVPRSSKKLFEDNEYALYTVTLFTRVADNFRIAAREKGFQVRDFEQSVEAQETRKQELAKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRTFAESIMRYGLPPAFLACVLSPAVKSEKKVRSILERLCDSTNSLYWKSEEDAGAMAGLAGDSETHPYVSFTINLA A50F11D168F31C97 wnk8_arath Serine/threonine-protein kinase WNK8 WNK8 Protein kinase with no lysine 8 MJC20.9 At5g41990 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASGSGFLGQISSMEEADFAEKDPSGRYIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEKCLLPASSRPTALELSKDPFLARDGGKDSALLASSSTSSKYVRPPQLEHLPMDVDHNENKSVSSNEDYPWSQTIELQRIAENKEFRLRGERSDDVTASMVLRIADPSGKCRIVHFAFYLESDTATAIAEEMVEELHLTSQEVVVIADMIDDFIMQLLSDRTSSHHNQNSPRLTHEDHEAANQQTVNSKDEEAAGQSMKSDISADYYFPYSANDGNAAMEAGRDAESMSSYLDSCSMMSTIYNLSISDNDYPEDLKTELNLIESQFNQSFQDLLKLKEDAIENAKRKWITKKQKAVNIS 0342EE9FDB5A0F54 vha_c-wnk8-1 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2 Specific interaction between AtWNK8 and AtVHA-C FEBS-Letters mint wnk8-vha_c 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1772270: original sequence: 333-550 : ENKEFRLRGERSDDVTASMVLRIADPSGKCRIVHFAFYLESDTATAIAEEMVEELHLTSQEVVVIADMIDDFIMQLLSDRTSSHHNQNSPRLTHEDHEAANQQTVNSKDEEAAGQSMKSDISADYYFPYSANDGNAAMEAGRDAESMSSYLDSCSMMSTIYNLSISDNDYPEDLKTELNLIESQFNQSFQDLLKLKEDAIENAKRKWITKKQKAVNI Stoichiometry: 1.0 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F3C AtVHA-C was found to bind to full length AtWNK8 FEBS-Letters mint vha_c-wnk8-2 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1788991: original sequence: 134-267 : DDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPEDIVESEHLVTLLAVVPKYSQKDWLACYETLTDYVVPRSSKKLFEDNEYALYTVTLFTRVADNFRIAAREKGFQVRDFEQSVEAQETRKQELAK Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation F5A AtWNK8 phosphorylates AtVHA-C FEBS-Letters mint wnk8-wnk8 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:15:41 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was '451-550' range MINT-1789974: original sequence: 451-550 : SDISADYYFPYSANDGNAAMEAGRDAESMSSYLDSCSMMSTIYNLSISDNDYPEDLKTELNLIESQFNQSFQDLLKLKEDAIENAKRKWITKKQKAVNI Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation F4B AtWNK8 is an active kinase and shows trans-autophosphorylation. FEBS-Letters mint wnk8-wnk8-1 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role self self purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:13:13 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Lys41Met range MINT-1789980: original sequence: 41-41 : YKAFDEVDGIEVAWNLVSIE undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:06:49 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Asp157Ala range MINT-1790004: original sequence: 157-157 : CDNIFVNGNTGEVKIGDLGL Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role self self purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:15:13 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Lys41Met range MINT-1789999: original sequence: 41-41 : YKAFDEVDGIEVAWNLVSIE gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:06:46 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Asp157Ala range MINT-1790001: original sequence: 157-157 : CDNIFVNGNTGEVKIGDLGL Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation F4A AtWNK8 is an active kinase and shows trans-autophosphorylation. FEBS-Letters mint