IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional analysis of EID1, an F-box protein involved in phytochrome A-dependent light signal transduction. Functional analysis of EID1, an F-box protein involved in phytochrome A-dependent light signal transduction. Plant J. (0960-7412) 2006 Marrocco K., Zhou Y., Bury E., Dieterle M., Funk M., Genschik P., Krenz M., Stolpe T., Kretsch T. A directed yeast two hybrid assay was used in this study. Figure 3(A) and (B). thomas.kretsch@biologie.uni-freiburg.de yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Marrocco K., Zhou Y., Bury E., Dieterle M., Funk M., Genschik P., Krenz M., Stolpe T., Kretsch T. A directed yeast two hybrid assay was used in this study. Figure 3(A) and (B). thomas.kretsch@biologie.uni-freiburg.de Plant J. (0960-7412) 2006 Functional analysis of EID1, an F-box protein involved in phytochrome A-dependent light signal transduction. Functional analysis of EID1, an F-box protein involved in phytochrome A-dependent light signal transduction. Plant J. (0960-7412) 2006 Marrocco K., Zhou Y., Bury E., Dieterle M., Funk M., Genschik P., Krenz M., Stolpe T., Kretsch T. A directed yeast two hybrid assay was used in this study. Figure 3(A) and (B). thomas.kretsch@biologie.uni-freiburg.de sinal Sinapis alba (White mustard) Brassica hirta White mustard bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Marrocco K., Zhou Y., Bury E., Dieterle M., Funk M., Genschik P., Krenz M., Stolpe T., Kretsch T. A directed yeast two hybrid assay was used in this study. Figure 3(A) and (B). thomas.kretsch@biologie.uni-freiburg.de Plant J. (0960-7412) 2006 Functional analysis of EID1, an F-box protein involved in phytochrome A-dependent light signal transduction. Functional analysis of EID1, an F-box protein involved in phytochrome A-dependent light signal transduction. Plant J. (0960-7412) 2006 Marrocco K., Zhou Y., Bury E., Dieterle M., Funk M., Genschik P., Krenz M., Stolpe T., Kretsch T. A directed yeast two hybrid assay was used in this study. Figure 3(A) and (B). thomas.kretsch@biologie.uni-freiburg.de yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Marrocco K., Zhou Y., Bury E., Dieterle M., Funk M., Genschik P., Krenz M., Stolpe T., Kretsch T. A directed yeast two hybrid assay was used in this study. Figure 3(A) and (B). thomas.kretsch@biologie.uni-freiburg.de Plant J. (0960-7412) 2006 ask14_arath SKP1-like protein 14 At2g03170 ASK14 T18E12.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTEVPLQNVTGKILSIVVEYCKKHVVDEESDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEEIREIFNIENDFTPEEEAAVRKENAWAFE DIP protein O81057 original sequence version: 91 276BB2CB0AF5DE01 cul1_arath Cullin-1 CUL1 At4g02570 T10P11.26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERKTIDLEQGWDYMQTGITKLKRILEGLNEPAFDSEQYMMLYTTIYNMCTQKPPHDYSQQLYDKYREAFEEYINSTVLPALREKHDEFMLRELFKRWSNHKVMVRWLSRFFYYLDRYFIARRSLPPLNEVGLTCFRDLVYNELHSKVKQAVIALVDKEREGEQIDRALLKNVLDIYVEIGMGQMERYEEDFESFMLQDTSSYYSRKASSWIQEDSCPDYMLKSEECLKKERERVAHYLHSSSEPKLVEKVQHELLVVFASQLLEKEHSGCRALLRDDKVDDLSRMYRLYHKILRGLEPVANIFKQHVTAEGNALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTECFQNHTLFHKALKEAFEIFCNKTVAGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLLFDRSANDDHERSILTKLKQQCGGQFTSKMEGMVTDLTLARENQNSFEDYLGSNPAANPGIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHINGKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKILLKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPLPPVDERKKVVEDVDKDRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYLA DIP protein Q94AH6 original sequence version: 102 DIP protein Q94AH6 original sequence version: 95 45041357DE8DAD8C ask11_arath SKP1-like protein 11 ASK11 At4g34210 F10M10.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKHHVDEANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE DIP protein O49484 original sequence version: 96 95D23CC17C1523B0 skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE DIP protein Q39255 original sequence version: 115 DIP protein Q39255 original sequence version: 118 DIP protein Q39255 original sequence version: 108 DIP protein Q39255 original sequence version: 88 DIP protein Q39255 original sequence version: 100 56B84C19FD5ABF17 ask3_arath SKP1-like protein 3 ASK3 At2g25700 F3N11.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETKKMIILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSTENHELKTWDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVADQMRGKTPAQMREHFNIKNDYTPEEEAEVRNENRWAFE 8F7C7796CE5CEB4F ask15_arath SKP1-like protein 15 ASK15 T5M7.16 At3g25650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLTSSDGESFQVEEVVARKLQIVKHLLEDDCVINEIPLQNVTGNILSIVLEYCKKHVDDVVDDDASEEPKKKKPDDEAKQNLDAWDAEFMKNIDMETIFKLILAANYLNVEGLLGLTCQTVADYIKDKTPEEVRELFNIENDFTHEEEEEAIRKENAWAFEADTKHEDPKP 05C92321D745D219 eid1_arath Phytochrome A-associated F-box protein Empfindlicher im dunkelroten Licht protein 1 EID1 At4g02440 T14P8.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAESVFSCIPEDVVFNIFFKLQDDPRNWARLACVCTKFSSIVRNVCCKTQCYSAIPTVISDLLPLPPSAAASASSSTAADSSLTPPGGWASLYKLAVCCPGLFHAGILLENSDFGLERELGPDQNLDPKPTTTDLALNDEEVSKPVGSGLETTSFWSLYDDLYTDTIPAPPPEDSIDDQEEEIETSEIRPGRDLPVRKRRKICRSLGSHLASGGWNLSREQGNKLLASRFRGDCLYICNWPGCIHVEEKRNYMLFRGVFKDFKRSRVWRTINDGNRSKTSGLKCAFCLCDETWDLHSSFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTALPLYT 0E4231CCF243487C ask18_arath SKP1-like protein 18 At1g10230 F14N23.11 ASK18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKILLTSSDGESFEIDEAVARKFLIIVHMMEDNCAGEAIPLENVTGDILSKIIEYAKMHVNEPSEEDEDEEAKKNLDSWDAKFMEKLDLETIFKIILAANYLNFEGLLGFASQTVADYIKDKTPEEVREIFNIENDFTPEEEEEIRKENAWTFNE 5DF3C1D971B73981 ask10_arath SKP1-like protein 10 At3g21860 ASK10 MSD21.23 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTKKIILKSSDGHSFEVEEEAACQCQTIAHMSEDDCTDNGIPLPEVTGKILEMVIEYCNKHHVDAANPCSDEDLKKWDKEFMEKYQSTIFDLIMAANYLNIKSLLDLACQTVADMIKDNTVEHTRKFFNIENDYTHEEEEAVRRENQWGFE 77AFFBAD7232A0AE skp1b_arath SKP1-like protein 1B SKP1-like 2 UFO-binding protein 2 ASK2 UIP2 At5g42190 MJC20.30 SKP1B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE DIP protein Q9FHW7 original sequence version: 101 DIP protein Q9FHW7 original sequence version: 104 DIP protein Q9FHW7 original sequence version: 86 9695CC9F57FC935F ask9_arath SKP1-like protein 9 At3g21850 ASK9 MSD21.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTKKIILKSSDGHSFEVEEEAARQCQIIIAHMSENDCTDNGIPLPNVTGKILAMVIEYCNKHHVDAANPCSDDDLKKWDKEFMEKDTSTIFDLIKAANYLNIKSLFDLACQTVAEIIKGNTPEQIREFFNIENDLTPEEEAAIRRENKWAFE 7F5965319CFAF4F9 ask19_arath SKP1-like protein 19 At2g03160 ASK19 T18E12.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKKIVLTSSDGESFKVEEVVARKLQIVGHIIEDDCATNKIPIPNVTGEILAKVIEYCKKHVEDDDDVVETHESSTKGDKTVEEAKKKPDDVAVPESTEGDDEAEDKKEKLNEWDAKFMKDFDIKTIFDIILAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIENDFTPEEEEAIRNENAWTFEQDGKQQVPKP 80F8609914DC6C87 ask16_arath SKP1-like protein 16 At2g03190 ASK16 T18E12.14 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLTSSDDESFEVEEAVARKLKVIAHMIDDDCADKAIPLENVTGNILALVIEYCKKHVLDDVDDSDDSTEATSENVNEEAKNELRTWDAEFMKEFDMETVMKLILAVNYLNVQDLLGLTCQTVADHMKDMSPEEVRELFNIENDYTPEEEDAIRKENAWAFEDLK DIP protein O81055 original sequence version: 92 B75BEB9552CF7048 ask13_arath SKP1-like protein 13 ASK13 At3g60010 F24G16.280 T2O9.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKMVMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANGVPIANVTGVILSKVIEYCKKHVVSDSPTEESKDELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGKKPDEIRALLGIENDFTPEEEEEIRKENQWAFE DIP protein Q9M1X5 original sequence version: 75 FF771FCF3B9844A5 ask4_arath SKP1-like protein 4 T20H2.8 At1g20140 ASK4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLTCKAVADQMRGKTPEQMRAHFNIKNDYTPEEEAEVRNENKWAFE DIP protein Q9LNT9 original sequence version: 89 9B0AD6B569A5F932 eid1-ask1 3 10 unspecified role unspecified role bait bait f-box required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 7 unspecified role unspecified role prey prey physical association physical association eid1-ask2 3 10 unspecified role unspecified role bait bait f-box required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 13 unspecified role unspecified role prey prey physical association physical association eid1-t20h2_8 3 18 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait f-box required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range physical association physical association eid1-at4g34210 3 10 unspecified role unspecified role bait bait f-box required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 6 unspecified role unspecified role prey prey physical association physical association eid1-f24g16_280 3 10 unspecified role unspecified role bait bait f-box required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 17 unspecified role unspecified role prey prey physical association physical association eid1-at2g03170 3 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait f-box required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range physical association physical association cul1-ask1-3 3 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-ask2 3 13 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-at2g25700 3 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-t20h2_8 3 18 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-at3g21860 3 5 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-at4g34210 3 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-f24g16_280 3 5 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-q9li78 3 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-f14n23_11 3 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-at2g03160 3 5 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-ask1-5 2 5 unspecified role unspecified role neutral component neutral component region C-terminal region yellow fluorescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region N-terminal region yellow fluorescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. EID1 (Q8LEA8) appears to stabilise the interaction between ASK1 and CUL1. eid1-ask2-1 2 13 unspecified role unspecified role neutral component neutral component region N terminal yellow fluorescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region C terminal yellow fluorescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. eid1-t20h2_8-1 2 18 unspecified role unspecified role neutral component neutral component region N terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region C terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. eid1-at3g21850 2 10 unspecified role unspecified role neutral component neutral component region C terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component region N terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. eid1-at4g34210-1 2 6 unspecified role unspecified role neutral component neutral component region N terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region C terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. eid1-f24g16_280-1 2 17 unspecified role unspecified role neutral component neutral component region N-terminal region yellow fluorescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region C terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. eid1-at2g03170-1 2 4 unspecified role unspecified role neutral component neutral component region N terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region C terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. eid1-q9li78 2 9 unspecified role unspecified role neutral component neutral component region N terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region C terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. cul1-ask1-4 2 5 unspecified role unspecified role neutral component neutral component region C terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region N terminal yellow flourescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. Only a weak signal was observed in this case, indicating a weak interaction between the proteins. eid1-ask1-6 2 10 unspecified role unspecified role neutral component neutral component f-box required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range region C terminal yellow fluorescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region N-terminal region yellow fluorescent protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The proteins co-localised to the nucleus. The arabidopsis SKP1 like proteins (ASK1 (Q39255), ASK2 (Q9FHW7), ASK3 (Q9SL93), ASK11 (O49484) and ASK14 (O81058)) appeared to stabilise the interaction between CUL1 and EID1. cul1-o81055 3 5 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Yeast growth was only observed on weak selection media (-LWH). cul1-ask1-6 1 5 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association The presence of EID1 (UniProt Q8LEA8) enabled yeast strains to grow for over 5 days on strong selection media, indicating EID1 stabilises the interaction between ASK1 and CUL1. prey = skp1a, bait=cul1, third-guy=eid1 revisit when additional component is in place cul1-t20h2_8-1 1 18 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association The presence of EID1 (UniProt Q8LEA8) enabled yeast strains to grow for over 5 days on strong selection media, indicating EDI1 stabilises the interaction between ASK4 and CUL1. bait =cul1, prey= T20H2.8, third-guy=eid1 revisit when additional componenet is in place cul1-at4g34210-1 1 6 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association The presence of EID1 (UniProt Q8LEA8) enabled yeast strains to grow for over 5 days on strong selection media, indicating EDI1 stabilises the interaction between ASK11 and CUL1. bait= cul1, prey=at4g34210, third_guy=eid1 revisit when additional component is in place cul1-q9li78-1 1 4 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association The presence of EID1 (UniProt Q8LEA8) enabled yeast strains to grow for over 5 days on strong selection media, indicating EDI1 stabilises the interaction between ASK14 and CUL1. bait=cul1, prey= q9li78, third-guy=eid1 revisit when addtional component is in place