IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ DPM1, the catalytic subunit of dolichol-phosphate mannose synthase, is tethered to and stabilized on the endoplasmic reticulum membrane by DPM3. DPM1, the catalytic subunit of dolichol-phosphate mannose synthase, is tethered to and stabilized on the endoplasmic reticulum membrane by DPM3. J. Biol. Chem. (0021-9258) 2006 imex curation Ashida H., Maeda Y., Kinoshita T. The origin of the ALDH protein could not be ascertained and as it was used a control it was ommited from this entry. tkinoshi@biken.osaka-u.ac.jp 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ashida H., Maeda Y., Kinoshita T. The origin of the ALDH protein could not be ascertained and as it was used a control it was ommited from this entry. tkinoshi@biken.osaka-u.ac.jp Accepted 2006-AUG-29 by JYOTI. 13-SEP-2006: Contacted by JYOTI J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation dpm1_human Dolichol-phosphate mannosyltransferase subunit 1 DPM1 Dolichol-phosphate mannose synthase subunit 1 Dolichyl-phosphate beta-D-mannosyltransferase subunit 1 Mannose-P-dolichol synthase subunit 1 protein protein human Homo sapiens Human MASLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSDRILLRPREKKLGLGTAYIHGMKHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT 9792145BFC8F0514 q4ldx8_crigr Dolichol-phosphate mannosyltransferase subunit 3 DPM3 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MTKLAQWLWGLALLGSAWAALTMGALGLELPFPCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQILEARADLARRGLRF A336B4A1646D3E5B chip_human E3 ubiquitin-protein ligase CHIP CHIP STUB1 PP1131 Carboxy terminus of Hsp70-interacting protein STIP1 homology and U box-containing protein 1 CLL-associated antigen KW-8 Antigen NY-CO-7 RING-type E3 ubiquitin transferase CHIP protein protein human Homo sapiens Human MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY 7E7D6568B17070BF dpm1-dpm3 1 2 unspecified role unspecified role prey prey region 11 amino acid region of Herpes Simplex Virus tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q4LDX8:p.[Leu74Ser;Ile78Thr;Leu85Ser] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain I T Fri Jul 22 11:15:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu74ser,leu85ser,ile78thr' Wed May 02 14:37:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu74ser,ile78thr,leu85ser' Tue Jun 30 17:44:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu74Ser;Ile78Thr;Leu85Ser]' physical association physical association Figure 3 Authors comment that the coexpression of DPM1 (Q4LDX8) enhanced expression of DPM3 (O60762). dpm1-chip 1 4 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region 11 amino acid region of Herpes Simplex Virus tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 6 lactacystin