IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification and functional characterization of Arabidopsis PEROXIN4 and the interacting protein PEROXIN22. Identification and functional characterization of Arabidopsis PEROXIN4 and the interacting protein PEROXIN22. Plant Cell (1040-4651) 2005 imex curation Zolman BK., Monroe-Augustus M., Silva ID., Bartel B. bartel@rice.edu 13-SEP-2006: Contacted by JYOTI Arabidopsis cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zolman BK., Monroe-Augustus M., Silva ID., Bartel B. bartel@rice.edu Accepted 2006-AUG-29 by JYOTI. 13-SEP-2006: Contacted by JYOTI Arabidopsis cDNA library Plant Cell (1040-4651) 2005 Only protein-protein interactions imex curation pex22_arath Peroxisome biogenesis protein 22 At3g21865 PEX22 Peroxin-22 MSD21.24 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAESSSPSPTEEIVRLIKRLSAYVAFKMSSLFSTTSIRNLDSRSIGAIAGLAIAVIFTWRAIRTPGEQRQRRQPKRRIHNAETSSAAAAASQSNLASSVAPEVSSPREDNAVQDVVDQFFQPVKPTLGQIVRQKLSEGRKVTCRLLGVILEETSPEELQKQATVRSSVLEVLLEITKYSDLYLMERVLDDESEAKVLQALENAGVFTSGGLVKDKVLFCSTEIGRTSFVRQLEPDWHIDTNPEISTQLARFIKYQLHVATVKPERTAPNVFTSQSIEQFFGSV 9B8E5B52BFB86259 pex4_arath Protein PEROXIN-4 PEX4 UBC21 F18A17.10 At5g25760 Ubiquitin carrier protein 21 Probable ubiquitin-conjugating enzyme E2 21 E2 ubiquitin-conjugating enzyme 21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQASRARLFKEYKEVQREKVADPDIQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDVRGFNSMAQMYTRLAAMPKKG 36FB1E11684F48B4 pex4-pex22 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 5