UniProt UniProt http://www.uniprot.org Regulation of nuclear proteasome by Rhp6/Ubc2 through ubiquitination and destruction of the sensor and anchor Cut8. Regulation of nuclear proteasome by Rhp6/Ubc2 through ubiquitination and destruction of the sensor and anchor Cut8. Cell (0092-8674) 2005 Takeda K., Yanagida M. yanagida@kozo.lif.kyoto-u.ac.jp 01-DEC-2006: Contacted by JYOTI. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Takeda K., Yanagida M. yanagida@kozo.lif.kyoto-u.ac.jp Accepted 2006-NOV-17 by DAVET. 01-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2005 Regulation of nuclear proteasome by Rhp6/Ubc2 through ubiquitination and destruction of the sensor and anchor Cut8. Regulation of nuclear proteasome by Rhp6/Ubc2 through ubiquitination and destruction of the sensor and anchor Cut8. Cell (0092-8674) 2005 Takeda K., Yanagida M. yanagida@kozo.lif.kyoto-u.ac.jp 01-DEC-2006: Contacted by JYOTI. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Takeda K., Yanagida M. yanagida@kozo.lif.kyoto-u.ac.jp Accepted 2006-NOV-17 by DAVET. 01-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2005 Regulation of nuclear proteasome by Rhp6/Ubc2 through ubiquitination and destruction of the sensor and anchor Cut8. Regulation of nuclear proteasome by Rhp6/Ubc2 through ubiquitination and destruction of the sensor and anchor Cut8. Cell (0092-8674) 2005 Takeda K., Yanagida M. yanagida@kozo.lif.kyoto-u.ac.jp 01-DEC-2006: Contacted by JYOTI. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Takeda K., Yanagida M. yanagida@kozo.lif.kyoto-u.ac.jp Accepted 2006-NOV-17 by DAVET. 01-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2005 Regulation of nuclear proteasome by Rhp6/Ubc2 through ubiquitination and destruction of the sensor and anchor Cut8. Regulation of nuclear proteasome by Rhp6/Ubc2 through ubiquitination and destruction of the sensor and anchor Cut8. Cell (0092-8674) 2005 Takeda K., Yanagida M. yanagida@kozo.lif.kyoto-u.ac.jp 01-DEC-2006: Contacted by JYOTI. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Takeda K., Yanagida M. yanagida@kozo.lif.kyoto-u.ac.jp Accepted 2006-NOV-17 by DAVET. 01-DEC-2006: Contacted by JYOTI. Cell (0092-8674) 2005 cut8_schpo Tethering factor for nuclear proteasome cut8 Cell untimely torn protein 8 cut8 SPAC17C9.13c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast METLSYSQIKKRKADFDEDISKRARQLPVGEQLPLSRLLQYSDKQQLFTILLQCVEKHPDLARDIRGILPAPSMDTCVETLRKLLINLNDSFPYGGDKRGDYAFNRIREKYMAVLHALNDMVPCYLPPYSTCFEKNITFLDAATNVVHELPEFHNPNHNVYKSQAYYELTGAWLVVLRQLEDRPVVPLLPLEELEEHNKTSQNRMEEALNYLKQLQKNEPLVHERSHTFQQTNPQNNFHRHTNSMNIGNDNGMGWHSMHQYI 20A7C1C554CD8C0C 20A7C1C554CD8C0C rpn11_schpo 26S proteasome regulatory subunit rpn11 Protein pad1 rpn11 bfr2 pad1 sks1 SPAC31G5.13 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MESLQRLLQGARMGTGMMGDQPLVDNSECVYISSLALLKMLRHGRHGTPMEVMGLMLGEFVDDFTVRVVDVFAMPQSGTGVSVEAVDPVFQKNMMDMLKQTGRPEMVVGWYHSHPGFGCWLSSVDINTQQSFEQLTPRAVAVVVDPIQSVKGKVVIDAFRLINPSTLMMGQEPRQTTSNLGHINKPSIQALIHGLGRHYYSLRINYKKTELEEIMLLNLHKQPWAHGLLLENFNSAAEKNHASIDKMKSLSEQYTERVQNEVTLSPEQLRIQYVGKQDPKKHLDAEVQKCIDNNISSMLACMLDSVAF 57E27C556B34E214 rpn1_schpo 26S proteasome regulatory subunit rpn1 Proteasome non-ATPase subunit mts4 19S regulatory cap region of 26S protease subunit 2 rpn1 mts4 SPBP19A11.03c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSKDISSKSPSGNDALNDKKGTKTSETNDRNSTNNTKERDELEDLSEEDLQLKNDLELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPLKFLRPHYFTLVKIYDSWPQSPQKTQLADILSVLGMSYSNTSKHESLKYRLQGVTTDPSLWGHEYVRHLASEIEEEFASRQEEEAPTDDLMELALTIVPFFLTHNAEADAIDLLQELGAIEKVVPFVELDNASRVCLYITSCVNLLPFPEDVAMLRTAHAIYRKFDQLTQALNVAIRLDDMSLIKEDCEAATDPLLKKQMSYMLARQQIPMDMGDEELNDALNNTHLSDHFHYLGKELNLMDPKVPEDIFKTHLEVARTGLGASGVYSAKQNLANTFVNALVNAGYSNDRLILVDDEKTSWIYKNKESGLISATASIGLLQLWNVDMGLSLLDKYLYSSEENTKAGALLGIGVTNVAVRNEADPAMAILSEYLETGSVKLRASAILGLGLAYSGANREDLLDMLSPIVTDTDCPMQLSCLAALSLGLIFVGTCNGDVASTILQTLMEREESAQNDQWGRFMALGLALLFNGKQDLADATVETLKAIEGKIARQAEILVDICSYAGTGNVLHIQKLLHICSEPPSDDAKESETTIQTFAALGVATIAMGEDIGAEMVLRHFDHMMHYGEPSIRKAIPLALGLLSASNPQMRIFDTLSRYSHDNDLDVAYNAIFAMGLVGAGTSNARLAQLLRQLASYYHKESNALFMVRIAQGLLYLGKGTMTLNPYHTERQILGQTAFAGLMTVVLAMLDANTFVLDTSHWLLYAITLAIRPRMLITLGEDGQYLPVSVRVGQAVDVVGQAGRPKVITGWVTHTTPVLLHHNERAELATEAYTPLTSLEGIVILKKNTEDIEMTA 03FC9AB767745C5A ubc2_schpo Ubiquitin-conjugating enzyme E2 2 Ubiquitin-protein ligase 2 Ubiquitin carrier protein 2 RAD6 homolog rhp6 ubc2 SPAC18B11.07c E2 ubiquitin-conjugating enzyme 2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFDEQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNNASPANAEAAQLHRENKKEYVRRVRKTVEDSWES E4A88A40ECF35709 rpn12_schpo 26S proteasome regulatory subunit rpn12 rpn12 mts3 SPBC16G5.01 SPBC342.07 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSTLDLNHLADLYDRKDWNACKKELLKLKVELAKQNLFVPTSDKEKASFARNVFEYGVLVSIQTCDIESFARYASQVIPFYHDSLVPSSRMGLVTGLNLLYLLSENRIAEFHTALESVPDKSLFERDPYVEWVISLEQNVMEGAFDKVASMIRSCNFPEFSYFMKIVMSMVRNEIATCAEKVYSEIPLSNATSLLYLENTKETEKLAEERGWDIRDGVIYFPKEANALETEDGMLIDEEDELELPPTASKHTISSIRQLLSYTSELEQIV C1BC6571722A034D psa4_yeast Proteasome subunit alpha type-4 PRE6 YOL038W Proteasome component PRE6 Macropain subunit PRE6 Proteinase YSCE subunit PRE6 Multicatalytic endopeptidase complex subunit PRE6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH 73AEE63B836E618A 73AEE63B836E618A cut8-rpn12-1 3 5 unspecified role unspecified role bait bait c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2A cut8-rpn11-1 2 5 unspecified role unspecified role bait bait c-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 6 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association Fig. 2B cut8-rpn1-1 2 7 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 5 unspecified role unspecified role bait bait c-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association Fig. 2B, 2D cut8-rpn12-2 2 5 unspecified role unspecified role bait bait c-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P38937:p.[Lys10Arg;Lys11Arg;Lys13Arg;Lys22Arg;Lys44Arg;Lys57Arg] lys10arg lys11arg lys13arg lys22arg lys44arg lys57arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Fri Jul 22 11:00:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys13arg,lys44arg,lys11arg,lys57arg,lys22arg,lys10arg' Wed May 02 15:21:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys10arg,lys11arg,lys13arg,lys22arg,lys44arg,lys57arg' Tue Jun 30 19:16:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys10Arg;Lys11Arg;Lys13Arg;Lys22Arg;Lys44Arg;Lys57Arg]' schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 9 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association Fig. 2B, 2C cut8-pre6-1 2 5 unspecified role unspecified role bait bait c-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P38937:p.[Lys10Arg;Lys11Arg;Lys13Arg;Lys22Arg;Lys44Arg;Lys57Arg] lys10arg lys11arg lys13arg lys22arg lys44arg lys57arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Fri Jul 22 11:03:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys11arg,lys57arg,lys10arg,lys44arg,lys13arg,lys22arg' Wed May 02 15:54:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys10arg,lys11arg,lys13arg,lys22arg,lys44arg,lys57arg' Tue Jun 30 16:07:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys10Arg;Lys11Arg;Lys13Arg;Lys22Arg;Lys44Arg;Lys57Arg]' schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 10 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2B, 2C, 2D cut8-rpn1-2 2 7 unspecified role unspecified role prey prey schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 5 unspecified role unspecified role bait bait c-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2D cut8-pre6-2 2 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association Fig. 2D cut8-rpn1-3 1 8 unspecified role unspecified role ancillary ancillary 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3B, 5B cut8-rpn1-4 4 8 unspecified role unspecified role ancillary ancillary 5 unspecified role unspecified role bait bait c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey association association Fig. 4D