IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human follitropin receptor (FSHR) interacts with the adapter protein 14-3-3tau. Human follitropin receptor (FSHR) interacts with the adapter protein 14-3-3tau. Mol. Cell. Endocrinol. (0303-7207) 2004 imex curation Cohen BD., Nechamen CA., Dias JA. fig 1, Table 2 james.dias@wadsworth.org Human ovarian cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cohen BD., Nechamen CA., Dias JA. fig 1, Table 2 james.dias@wadsworth.org Annotation to indicate that this entry has been checked and accepted by a senior curator. Human ovarian cDNA library. Mol. Cell. Endocrinol. (0303-7207) 2004 Only protein-protein interactions imex curation Human follitropin receptor (FSHR) interacts with the adapter protein 14-3-3tau. Human follitropin receptor (FSHR) interacts with the adapter protein 14-3-3tau. Mol. Cell. Endocrinol. (0303-7207) 2004 imex curation Cohen BD., Nechamen CA., Dias JA. fig 1, Table 2 james.dias@wadsworth.org Human ovarian cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cohen BD., Nechamen CA., Dias JA. fig 1, Table 2 james.dias@wadsworth.org Annotation to indicate that this entry has been checked and accepted by a senior curator. Human ovarian cDNA library. Mol. Cell. Endocrinol. (0303-7207) 2004 Only protein-protein interactions imex curation Human follitropin receptor (FSHR) interacts with the adapter protein 14-3-3tau. Human follitropin receptor (FSHR) interacts with the adapter protein 14-3-3tau. Mol. Cell. Endocrinol. (0303-7207) 2004 imex curation Cohen BD., Nechamen CA., Dias JA. fig 1, Table 2 james.dias@wadsworth.org Human ovarian cDNA library. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cohen BD., Nechamen CA., Dias JA. fig 1, Table 2 james.dias@wadsworth.org Annotation to indicate that this entry has been checked and accepted by a senior curator. Human ovarian cDNA library. Mol. Cell. Endocrinol. (0303-7207) 2004 Only protein-protein interactions imex curation fshr_human Follicle-stimulating hormone receptor Follitropin receptor FSHR LGR1 protein protein human Homo sapiens Human MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCKVQLRHAASVMVMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKAKILLVLFHPINSCANPFLYAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTNGSTYILVPLSHLAQN 766BC421014CD5A4 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN DIP protein P27348 original sequence version: 164 DIP protein P27348 original sequence version: 173 175534325E9E37C4 fshr-ywhaq-1 2 5 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait physical association physical association P27348 cDNA library fshr-ywhaq-2 1 4 unspecified role unspecified role bait bait il 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association The interaction is weak and the construct with both intracellular loops L1 and L2 of human FSHR joined by a glycyl-seryl linker has greater interaction signal with 14-3-3 tau. fshr-ywhaq-3 3 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Addition of follitropin (FSH) to cells induces interaction. stable transfection of FSHR (P23945) P27348 over-expressed to check when CV delivery ready