IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Characterization of heterotrimeric G protein complexes in rice plasma membrane. Characterization of heterotrimeric G protein complexes in rice plasma membrane. Plant J. (0960-7412) 2004 imex curation Kato C., Mizutani T., Tamaki H., Kumagai H., Kamiya T., Hirobe A., Fujisawa Y., Kato H., Iwasaki Y. In some assays plama membranes from a mutant rice plants carrying a constitutively active form of the GPA1 protein (GPA1 Q223L) were analysed. The UniProt accession number for RGG2 was determined from the amino acid sequence given in Figure 1 of this paper using a amino acid similarity search against the UniProt database. iwasaki@fpu.ac.jp Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kato C., Mizutani T., Tamaki H., Kumagai H., Kamiya T., Hirobe A., Fujisawa Y., Kato H., Iwasaki Y. This experiment relates to a negative interaction iwasaki@fpu.ac.jp Accepted 2006-OCT-11 by JYOTI. Plant J. (0960-7412) 2004 Only protein-protein interactions imex curation Characterization of heterotrimeric G protein complexes in rice plasma membrane. Characterization of heterotrimeric G protein complexes in rice plasma membrane. Plant J. (0960-7412) 2004 imex curation Kato C., Mizutani T., Tamaki H., Kumagai H., Kamiya T., Hirobe A., Fujisawa Y., Kato H., Iwasaki Y. In some assays plama membranes from a mutant rice plants carrying a constitutively active form of the GPA1 protein (GPA1 Q223L) were analysed. The UniProt accession number for RGG2 was determined from the amino acid sequence given in Figure 1 of this paper using a amino acid similarity search against the UniProt database. iwasaki@fpu.ac.jp Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kato C., Mizutani T., Tamaki H., Kumagai H., Kamiya T., Hirobe A., Fujisawa Y., Kato H., Iwasaki Y. This experiment relates to a negative interaction. iwasaki@fpu.ac.jp Accepted 2006-OCT-11 by JYOTI. Plant J. (0960-7412) 2004 Only protein-protein interactions imex curation gbb_orysj Guanine nucleotide-binding protein subunit beta RGB1 WD40 repeat-containing protein 80 OSJNBa0039O18.9 LOC_Os03g46650 Os03g0669200 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MASVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTLQGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQSVACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTCVLWDVTTGQRISIFGGEFPSGHTADVLSLSINSSNSNMFVSGSCDATVRLWDIRIASRAVRTYHGHEGDINSVKFFPDGQRFGTGSDDGTCRLFDVRTGHQLQVYSREPDRNDNELPTVTSIAFSISGRLLFAGYSNGDCYVWDTLLAEVVLNLGNLQNSHEGRISCLGLSSDGSALCTGSWDKNLKIWAFSGHRKIV 36CE374E2A3E8EB0 gpa1_orysj Guanine nucleotide-binding protein alpha-1 subunit GPA1 D1 GA1 RGA1 OJ1005_D04.15 OSJNBa0049D13.1 Protein Dwarf1 LOC_Os05g26890 Os05g0333200 Protein Daikoku dwarf protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGSSCSRSHSLSEAETTKNAKSADIDRRILQETKAEQHIHKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELRSYTSVIHANVYQTIKILYEGAKELSQVESDSSKYVISPDNQEIGEKLSDIDGRLDYPLLNKELVLDVKRLWQDPAIQETYLRGSILQLPDCAQYFMENLDRLAEAGYVPTKEDVLYARVRTNGVVQIQFSPVGENKRGGEVYRLYDVGGQRNERRKWIHLFEGVNAVIFCAAISEYDQMLFEDETKNRMMETKELFDWVLKQRCFEKTSFILFLNKFDIFEKKIQKVPLSVCEWFKDYQPIAPGKQEVEHAYEFVKKKFEELYFQSSKPDRVDRVFKIYRTTALDQKLVKKTFKLIDESMRRSREGT 4EEFAEDAB4463612 gbb-gpa1-1 2 3 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association true 5a Both proteins were labelled with 35S-methionine and 35S-cysteine In vitro co-immunoprecipitation amoung the subunits of the G protein complexes. gbb-gpa1-2 1 3 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association true 5a Both proteins were labelled with 35S-methionine and 35S-cysteine