UniProt UniProt http://www.uniprot.org Regulation of checkpoint kinases through dynamic interaction with Crb2. Regulation of checkpoint kinases through dynamic interaction with Crb2. EMBO J. (0261-4189) 2004 Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. yanagida@kozo.biophys.kyoto-u.ac.jp 27-NOV-2006: Contacted by JYOTI. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast tap tandem affinity purification TAP TAP tap polyclonal western polyclonal antibody western blot polyclonal western Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. yanagida@kozo.biophys.kyoto-u.ac.jp Accepted 2006-NOV-15 by JYOTI. 27-NOV-2006: Contacted by JYOTI. EMBO J. (0261-4189) 2004 Regulation of checkpoint kinases through dynamic interaction with Crb2. Regulation of checkpoint kinases through dynamic interaction with Crb2. EMBO J. (0261-4189) 2004 Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. yanagida@kozo.biophys.kyoto-u.ac.jp 27-NOV-2006: Contacted by JYOTI. in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay predetermined predetermined participant predetermined Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. yanagida@kozo.biophys.kyoto-u.ac.jp Accepted 2006-NOV-15 by JYOTI. 27-NOV-2006: Contacted by JYOTI. EMBO J. (0261-4189) 2004 Regulation of checkpoint kinases through dynamic interaction with Crb2. Regulation of checkpoint kinases through dynamic interaction with Crb2. EMBO J. (0261-4189) 2004 Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. yanagida@kozo.biophys.kyoto-u.ac.jp 27-NOV-2006: Contacted by JYOTI. in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay predetermined predetermined participant predetermined Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. Self-phosphorylation was inferred from apparent shift in molecular weight following western blot. yanagida@kozo.biophys.kyoto-u.ac.jp Accepted 2006-NOV-15 by JYOTI. 27-NOV-2006: Contacted by JYOTI. EMBO J. (0261-4189) 2004 Regulation of checkpoint kinases through dynamic interaction with Crb2. Regulation of checkpoint kinases through dynamic interaction with Crb2. EMBO J. (0261-4189) 2004 Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. yanagida@kozo.biophys.kyoto-u.ac.jp 27-NOV-2006: Contacted by JYOTI. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down western blot western blot Immuno blot Immuno blot Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. yanagida@kozo.biophys.kyoto-u.ac.jp Accepted 2006-NOV-15 by JYOTI. 27-NOV-2006: Contacted by JYOTI. EMBO J. (0261-4189) 2004 Regulation of checkpoint kinases through dynamic interaction with Crb2. Regulation of checkpoint kinases through dynamic interaction with Crb2. EMBO J. (0261-4189) 2004 Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. yanagida@kozo.biophys.kyoto-u.ac.jp 27-NOV-2006: Contacted by JYOTI. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mochida S., Esashi F., Aono N., Tamai K., O'Connell MJ., Yanagida M. yanagida@kozo.biophys.kyoto-u.ac.jp Accepted 2006-NOV-15 by JYOTI. 27-NOV-2006: Contacted by JYOTI. EMBO J. (0261-4189) 2004 mpip_schpo M-phase inducer phosphatase cdc25 SPAC24H6.05 Mitosis initiation protein P80 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDSPLSSLSFTNTLSGKRNVLRPAARELKLMSDRNANQELDFFFPKSKHIASTLVDPFGKTCSTASPASSLAADMSMNMHIDESPALPTPRRTLFRSLSCTVETPLANKTIVSPLPESPSNDALTESYFFRQPASKYSITQDSPRVSSTIAYSFKPKASIALNTTKSEATRSSLSSSSFDSYLRPNVSRSRSSGNAPPFLRSRSSSSYSINKKKGTSGGQATRHLTYALSRTCSQSSNTTSLLESCLTDDTDDFELMSDHEDTFTMGKVADLPESSVELVEDAASIQRPNSDFGACNDNSLDDLFQASPIKPIDMLPKINKDIAFPSLKVRSPSPMAFAMQEDAEYDEQDTPVLRRTQSMFLNSTRLGLFKSQDLVCVTPKQSTKESERFISSHVEDLSLPCFAVKEDSLKRITQETLLGLLDGKFKDIFDKCIIIDCRFEYEYLGGHISTAVNLNTKQAIVDAFLSKPLTHRVALVFHCEHSAHRAPHLALHFRNTDRRMNSHRYPFLYYPEVYILHGGYKSFYENHKNRCDPINYVPMNDASHVMTCTKAMNNFKRNATFMRTKSYTFGQSVLASPDVNDSPTAMHSLSTLRRF CF8D430FC7BD38C1 chk1_schpo Serine/threonine-protein kinase chk1 Checkpoint kinase 1 chk1 rad27 SPCC1259.13 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAQKLDNFPYHIGREIGTGAFASVRLCYDDNAKIYAVKFVNKKHATSCMNAGVWARRMASEIQLHKLCNGHKNIIHFYNTAENPQWRWVVLEFAQGGDLFDKIEPDVGIDEDVAQFYFAQLMEGISFMHSKGVAHRDLKPENILLDYNGNLKISDFGFASLFSYKGKSRLLNSPVGSPPYAAPEITQQYDGSKVDVWSCGIILFALLLGNTPWDEAISNTGDYLLYKKQCERPSYHPWNLLSPGAYSIITGMLRSDPFKRYSVKHVVQHPWLTSSTPFRTKNGNCADPVALASRLMLKLRIDLDKPRLASSRASQNDSGFSMTQPAFKKNDQKELDRVEVYGALSQPVQLNKNIDVTEILEKDPSLSQFCENEGFIKRLAKKAKNFYEICPPERLTRFYSRASRETIIDHLYDSLRLLAISVTMKYVRNQTILYVNLHDKRKCLLQGVIELTNLGHNLELINFIKRNGDPLEWRKFFKNVVSSIGKPIVLTDVSQN 0DEB8E10541F7942 4ebp1_human Eukaryotic translation initiation factor 4E-binding protein 1 Phosphorylated heat- and acid-stable protein regulated by insulin 1 EIF4EBP1 protein protein human Homo sapiens Human MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI DIP protein Q13541 original sequence version: 96 DIP protein Q13541 original sequence version: 103 DIP protein Q13541 original sequence version: 120 DIP protein Q13541 original sequence version: 113 1682A6BA74132966 rad4_schpo S-M checkpoint control protein rad4 Protein cut5 P74 rad4 cut5 SPAC23C4.18c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGSSKPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDTPKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHFLPTLFKCRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEYALKWKINVVCVEWLWQSIQRNAVLEPQYFQLDMPAEKIGLGAYVRLDPNTTEAKSYSENQKISKNKEKSGQSLAALAEEADLEPVIMKRGKKRDRSILWEELNNGKFEFSSRSEENSVLLDDFTPETVQPLEENELDTELNIENEAKLFKNLTFYLYEFPNTKVSRLHKCLSDNGGQISEFLSSTIDFVVIPHYFPVDELPIFSFPTVNEWWIERCLYYKKIFGIDEHALAKPFFRPSLVPYFNGLSIHLTGFKGEELSHLKKALTILGAVVHEFLGVQRSILLVNTNEPFSMKTRFKIQHATEWNVRVVGVAWLWNIIQSGKFIDQVSPWAIDKKENQEIKKFTNQNNMVFPTSDRDTRLQNSLAQQPIGHSTPHNSPSLLSVKKRQNNHIRSNTLIQLNSNSKDSTIFPRRSVTVPGDKIDTVWKSSVTKPETPTSPQEHVSYIDPDAQREKHKLYAQLTSNVDAIPPANDLQNQENGLLLITESHRKLRRR C14EC1EC26863BEF rad3_schpo Protein kinase rad3 DNA repair protein rad3 rad3 SPBC216.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSQHAKRKAGSLDLSPRGLDDRQAFGQLLKEVLALDKEHELGRSNSLPSMTSELVEVLIEVGLLAFKHDDSKSEFISPKMLKEAHLSLQALMLILKRSPTVLREIKSSVTLLDWILPRTISLFADIRFIKLFDSLKEFHKLIYQLISEKSFLWDLYASFMRYWKYYITNVSSIVLQITNATFPYKMPSPNSQPLQSITPNYPTHREDKFDLLIINIEEACTFFFESAHFFAQCSYLKKSNFPSPPLFTAWTWIKPCFFNFVILLKRISIGDSQLFLHLHSRIVQTLCCFSLNFIYHGLPICEKSKHILMSSINLTLGSLKKTYTVANTAISLFFLSLFVLPKTVAGLFYPFGVSLLSDFKVLEQLEPDSDLKKAIILFKCRYQSSEIDQTTLRAFGEICTGKLENTLFSNSELNLFLLHYLSLDNDLSNILKVDFQNGHNICTFAKWCINNNLDEPSNLKHFREMLDYYSSHNVTISEDDLKNFSLVLCTHVAKVNEKTNSIFRTYEVHGCEVCNSFCLLFDERSLFKIPYHELFCALLKNPDIISSSVKQSLLLDGFFRWSQHCSNFNKESMLSLREFIMKALASTSRCLRVVAAKVLPIFIKGPNNLDIVEFHKESKALIFNTLKILAVENTAILETVILSWISLSRVVEEEELHFVLLEVISSVINSGIFYQGIGLSALQQIASTRHISVWQLLSPYWPTVSVAIVQGMGKKPNIASLFAQLMNISEGDFLIRTQAYTLPFLVLTKNKALIVRIAELSQSDVATLCLTNMHKILASLLTTDHPNLEESVMLLLSLATSDFEKVDLTSLLRSDPISITVELLQLYQNDVPHEKIENALRKVAMIVSQVVNDEDLSNKELLYDFFNNHILGILAEFSNILNDLKGKTSINEKIKTIVGIEKMLSLCGGAVKLGLPQILSNLQSAFQNEHLRFYAIKAWFSLILATKEPEYSSIAGLSLVILPPLFPYLEPQEAELVIQIFDFISSDTHKCLQGLKWAIPTSLDSACFSLKAKEIFCSLQNEDFYSELQSIIKCLTNENEPVCYLGLQKLELFFQAKVDELHDTLNLDISNEVLDQLLRCLLDCCVKYASTNMQISYLAAKNLGELGAIDPSRAKAQHIIKETVVLDNFENGEESLKFILDFMQSQLIPAFLVTTDTKAQGFLAYALQEFLKLGGFKSAVINKKKGLTVVTEHWMSLPDLSKRVLIPFLTSKYHLTPIPKIDIRYPIYKENVTIHTWMQLFSLKLMEYAHSQNAEKIFGICSKVVKDQEVNIPCFLLPFLVLNVILTESELEVNKVIEEFQLVINQPGPDGLNSVGQQRYTSFVDVFFKIVDYLNKWLRMRKKRNWDRRSAIARKENRYMSVEDATSRESSISKVESFLSRFPSKTLGIVSLNCGFHARALFYWEQHIRNATAPYAALESDYRVLQEIYAGIDDPDEIEAVSLNFHDYSFDQQLLLHENSGTWDSALSCYEIIIQKDPENKKAKIGLLNSMLQSGHYESLVLSLDSFIINDNHEYSKMLNLGIEASWRSLSIDSLKKCLSKSNLESFEAKLGSIFYQYLRKDSFAELTERLQPLYVDAATAIANTGAHSAYDCYDILSKLHAINDFSRIAETDGIVSDNLDIVLRRRLSQVAPYGKFKHQILSTHLVGYEKFENTKKTAEIYLEIARISRKNGQFQRAFNAILKAMDLDKPLATIEHAQWWWHQGQHRKAISELNFSLNNNMFDLVDEHEERPKNRKETLGNPLKGKVFLKLTKWLGKAGQLGLKDLETYYHKAVEIYSECENTHYYLGHHRVLMYEEEQKLPVNEQSERFLSGELVTRIINEFGRSLYYGTNHIYESMPKLLTLWLDFGAEELRLSKDDGEKYFREHIISSRKKSLELMNSNVCRLSMKIPQYFFLVALSQMISRVCHPNNKVYKILEHIIANVVASYPGETLWQLMATIKSTSQKRSLRGKSILNVLHSRKLSMSSKVDIKALSQSAILITEKLINLCNTRINSKSVKMSLKDHFRLSFDDPVDLVIPAKSFLDITLPAKDANRASHYPFPKTQPTLLKFEDEVDIMNSLQKPRKVYVRGTDGNLYPFLCKPKDDLRKDARLMEFNNLICKILRKDQEANRRNLCIRTYVVIPLNEECGFIEWVNHTRPFREILLKSYRQKNIPISYQEIKVDLDFALRSPNPGDIFEKKILPKFPPVFYEWFVESFPEPNNWVTSRQNYCRTLAVMSIVGYVLGLGDRHGENILFDEFTGEAIHVDFNCLFDKGLTFEKPEKVPFRLTHNMVDAMGPTGYEGGFRKASEITMRLLRSNQDTLMSVLESFLHDPLVEWNRKKSSSKYPNNEANEVLDIIRKKFQGFMPGETIPLSIEGQIQELIKSAVNPKNLVEMYIGWAAYF DDEA343FFA3872D3 rhp9_schpo DNA repair protein crb2 crb2 Checkpoint mediator protein crb2 Cut5-repeat binding protein 2 RAD9 protein homolog rhp9 SPBC342.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEVNDTSLHKGFGLDINSQRVFGAQAAISRNNYSKVNASINPSPPRSNDNSNKEFSYSKDVNNNGAVEELSLTQLFEVPSQAAFAKQSSQDISDDELIQHDSRKVISSPYSPKQTHTVLKRLYDRQSVISDHEKLLTPQNVSNSSQILSPFTSLLPSTLSTLKDTPLSVSQNEKNLETVGEVLVPETVAQHRTKFYDYTLDEMENETESGQVETTPTRLATSLGSPVLYGRVESTPPAFLPETSEKQYKRKFSFTEPSSEKVDNTETKFSKKTKNINDENFPNPFNVISSYETSASPSTVIDQSSQVSSIFVNKRLRKSVNNQAISRSDSLSLDTPKIDSLFTRASIKPLKPSQSPNSRRSFKNRVLAFFKGYPSFYYPATLVAPVHSAVTSSIMYKVQFDDATMSTVNSNQIKRFFLKKGDVVQSTRLGKIKHTVVKTFRSTNEQLSLIAVDALNNDMVILAHGEIEVTVPISTIYVAPVNIRRFQGRDLSFSTLKDMKFEETSFLPSHDSQRNRSSLKERDSSFVKKNLDSESNQLIFDDCVFAFSGPVHEDAYDRSALETVVQDHGGLVLDTGLRPLFNDPFKSKQKKLRHLKPQKRSKSWNQAFVVSDTFSRKVKYLEALAFNIPCVHPQFIKQCLKMNRVVDFSPYLLASGYSHRLDCTLSQRIEPFDTTDSLYDRLLARKGPLFGKKILFIIPEAKSWQKKIENTEQGQKALAHVYHALALGADVEIRPNVAHLECDLILTMDGNIVDETNCPVVDPEWIVECLISQSDIST 5E35178828E6E42A chk1-cdc25-1 2 6 enzyme target enzyme target substrate substrate unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role ancillary ancillary region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 7 enzyme enzyme unspecified role unspecified role c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P34208:p.Asp155Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:35:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp155ala' Tue Jun 30 17:21:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp155Ala' schpm Schizosaccharomyces pombe (fission yeast) Fission yeast phosphorylation phosphorylation reaction phosphorylation Fig. 1A, 1B, 1C This interaction is stimulated by UV irradiation or loss of function mutations in swi7, cdc6 or cdc20. chk1-chk1-1 3 11 unspecified role unspecified role ancillary ancillary region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 7 enzyme enzyme unspecified role unspecified role P34208:p.Asp155Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:41:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp155ala' Tue Jun 30 19:20:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp155Ala' c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 7 enzyme target enzyme target substrate substrate unspecified role unspecified role c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast phosphorylation phosphorylation reaction phosphorylation Fig. 1A, 1B, 1C This interaction is stimulated by UV irradiation or loss of function mutations in swi7, cdc6 or cdc20. rad3-rhp9-1 4 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3A rad3-rhp9-2 4 11 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3B, 3C, 4A, 4B This interaction is transiently reduced following UV irradiation. rad3-chk1-1 4 7 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 4C, 4D This interaction is transiently reduced following UV irradiation. rad3-rhp9-3 5 10 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 11 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain schpm Schizosaccharomyces pombe (fission yeast) Fission yeast physical association physical association Fig. 4F This interaction is reduced following prior UV irradiation of cells expressing rhp9/crb2. chk1-rhp9-1 4 7 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey physical association physical association Fig. 5A, 5B, 5C This interaction is transiently enhanced following UV irradiation. rhp9-cut5-1 1 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait n-terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 5D This interaction is enhanced following UV irradiation. rad3-eif4ebp1-1 2 11 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P87074:p.Ser666Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 11:00:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'sera66ala' Wed May 02 19:22:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser666ala' Tue Jun 30 17:18:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser666Ala' schpm Schizosaccharomyces pombe (fission yeast) Fission yeast 8 enzyme target enzyme target substrate substrate unspecified role unspecified role 10 enzyme enzyme unspecified role unspecified role n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q02099:p.Asp2249Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D E Wed May 02 18:55:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp2249glu' Tue Jun 30 19:19:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp2249Glu' schpm Schizosaccharomyces pombe (fission yeast) Fission yeast phosphorylation phosphorylation reaction phosphorylation Fig. 6