UniProt UniProt http://www.uniprot.org RASSF2 is a novel K-Ras-specific effector and potential tumor suppressor. RASSF2 is a novel K-Ras-specific effector and potential tumor suppressor. J. Biol. Chem. (0021-9258) 2003 imex curation Vos MD., Ellis CA., Elam C., Ulku AS., Taylor BJ., Clark GJ. also shown a very weak interaction rassf2-hras, coip fig 2c, not included. 293T cells have been transfected with KRAS and RASSF2. gclark@mail.nih.gov Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Vos MD., Ellis CA., Elam C., Ulku AS., Taylor BJ., Clark GJ. also shown a very weak interaction rassf2-hras, coip fig 2c, not included. 293T cells have been transfected with KRAS and RASSF2. gclark@mail.nih.gov Accepted 2006-JUL-5 by ORCHARD. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation RASSF2 is a novel K-Ras-specific effector and potential tumor suppressor. RASSF2 is a novel K-Ras-specific effector and potential tumor suppressor. J. Biol. Chem. (0021-9258) 2003 imex curation Vos MD., Ellis CA., Elam C., Ulku AS., Taylor BJ., Clark GJ. also shown a very weak interaction rassf2-hras, coip fig 2c, not included. 293T cells have been transfected with KRAS and RASSF2. gclark@mail.nih.gov Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Vos MD., Ellis CA., Elam C., Ulku AS., Taylor BJ., Clark GJ. also shown a very weak interaction rassf2-hras, coip fig 2c, not included. 293T cells have been transfected with KRAS and RASSF2. gclark@mail.nih.gov Accepted 2006-JUL-5 by ORCHARD. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation rask_human GTPase KRas KRAS RASK2 KRAS2 K-Ras 2 Ki-Ras c-K-ras c-Ki-ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM 973547B2E11C2C81 rasf2_human Ras association domain-containing protein 2 RASSF2 KIAA0168 CENP-34 protein protein human Homo sapiens Human MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPATI C29D16376904249E kras-rassf2-1 1 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P01116:p.Gly12Val constitutive activate mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 15:44:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 19:47:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' P01116:p.[Gly12Val;Glu37Gly] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E G certain certain sequence position certain certain certain sequence position certain G V Fri Jul 22 11:12:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu37gly,gly12val' Wed May 02 16:18:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val,glu37gly' Tue Jun 30 17:32:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly12Val;Glu37Gly]' P01116:p.[Gly12Val;Thr35Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T S certain certain sequence position certain certain certain sequence position certain G V Fri Jul 22 11:10:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr35ser,gly12val' Wed May 02 15:44:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val,thr35ser' Tue Jun 30 16:14:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly12Val;Thr35Ser]' P01116:p.[Gly12Val;Tyr40Cys] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y C certain certain sequence position certain certain certain sequence position certain G V Fri Jul 22 11:00:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40cys,gly12val' Wed May 02 16:58:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val,tyr40cys' Tue Jun 30 17:13:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly12Val;Tyr40Cys]' physical association physical association Interaction requires KRas to be in GTP-bound form. 2a and b krs-rassf2-2 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ra domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Farnesylated Kras was used. 3