UniProt UniProt http://www.uniprot.org Functional analysis of yeast gene families involved in metabolism of vitamins B1 and B6. Functional analysis of yeast gene families involved in metabolism of vitamins B1 and B6. Yeast (0749-503X) 2002 imex curation Rodriguez-Navarro S., Llorente B., Rodriguez-Manzaneque MT., Ramne A., Uber G., Marchesan D., Dujon B., Herrero E., Sunnerhagen P., Perez-Ortin JE. jose.e.perez@uv.es 13-SEP-2006: Contacted by JYOTI A library of genomic S. cerevisiae DNA from the his3 ade2 gal4 strain JB974 in the Gal4 activation domain (Gal4-AD) fusion vector pACT2 (13) was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Rodriguez-Navarro S., Llorente B., Rodriguez-Manzaneque MT., Ramne A., Uber G., Marchesan D., Dujon B., Herrero E., Sunnerhagen P., Perez-Ortin JE. jose.e.perez@uv.es Accepted 2006-AUG-29 by JYOTI. A library of genomic S. cerevisiae DNA from the his3 ade2 gal4 strain JB974 in the Gal4 activation domain (Gal4-AD) fusion vector pACT2 (13) was used. 13-SEP-2006: Contacted by JYOTI A library of genomic S. cerevisiae DNA from the his3 ade2 gal4 strain JB974 in the Gal4 activation domain (Gal4-AD) fusion vector pACT2 (13) was used. Yeast (0749-503X) 2002 Only protein-protein interactions imex curation aim18_yeast Altered inheritance of mitochondria protein 18, mitochondrial AIM18 FMP22 Found in mitochondrial proteome protein 22 YHR198C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDRGRCANMLKSLQRTLAKCQKSPSTNHWQCFKRNFTSIRATKYPGRSNSTFHYWPWFAASTLLATSLYYRDRPVQNDDKTDAFPSHTESIQVDSSVSDFPLTITALNFPVSTTFKLLGYGQRHVTFLRFKVYALGLYLAENDENLVSDTLNETYLHKYFLDVDDSKTPKENLARLLKRDDSKSVMMIDDLLDSGMRMLAKITPVRNTDFKHLKEGLVKTISKHPDVANNKDTLAKGLSELNDAFSRKGSVRKNDDLIIELLANGALQFSYHDSKNNEFEVMGVVNNQLVGKFLFSQYLCGEKSPSPQAKKTAIDKLITLL A6C07E03AE1EEC80 snz2_yeast Probable pyridoxal 5'-phosphate synthase subunit SNZ2 SNZ2 YNL333W N0290 PDX1 homolog 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEFKVKTGLAQMLKGGVIMDVVTPEQAIIAERAGACAVMALERIPADMRKSGQVCRMSDPRMIKEIMEAVSIPVMAKVRIGHFVEAQILEELQVDYIDESEVLTPADWTHHIEKHNFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHITKIKAEIQQYKENLKTESDFAAKATELRVPVDLLKTTLSEGKLPVVNFAAGGVATPADAALLMQLGCEGVFVGSGIFKSSDPEKLACAIVEATTHYDNPAKLLQISSDLGDLMGGISIQSINEAGGKNGARLSEIGW EE02E7C546C460AC snz1_yeast Pyridoxal 5'-phosphate synthase subunit SNZ1 SNZ1 PDX1 homolog 1 YM6543.03 YMR096W p35 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGEDFKIKSGLAQMLKGGVIMDVVTPEQAKIAEKSGACAVMALESIPADMRKSGKVCRMSDPKMIKDIMNSVSIPVMAKVRIGHFVEAQIIEALEVDYIDESEVLTPADWTHHIEKDKFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKHIRRITEEIKACQQLKSEDDIAKVAEEMRVPVSLLKDVLEKGKLPVVNFAAGGVATPADAALLMQLGCDGVFVGSGIFKSSNPVRLATAVVEATTHFDNPSKLLEVSSDLGELMGGVSIESISHASNGVRLSEIGW C5BC77711B415D9F thi11_yeast 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI11 THI11 Thiamine biosynthesis protein 11 Thiamine pyrimidine synthase J2250 YJR156C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTDKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDIAILEPTNPSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFGKIQIDELTKHYGMKPEDYTAVRCGMNVAKYIIEDKIDAGIGIECMQQVELEEYLAKQGRPASDAKMLRIDKLACLGCCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWKEYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEAQRLMAIHQEKCRQEGTFKRLALPA 1BA0A2D2A6D112D7 snz1-yhr198c 1 4 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association None snz2-thi11 1 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association None