IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Mol. Endocrinol. (0888-8809) 2002 imex curation Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Endocrinol. (0888-8809) 2002 Only protein-protein interactions imex curation Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Mol. Endocrinol. (0888-8809) 2002 imex curation Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Only protein-protein interactions rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Brendel C., Gelman L., Auwerx J. The interaction occurred in the presence of the ligand of PPAR-gamma - 10-6 M of rosiglitazone. A modified mammalian two-hybrid system was used in which MBF-1 (O60869) was no longer fused to an artificial transactivating domain but experssed as the full-length, wild-type protein. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Endocrinol. (0888-8809) 2002 Only protein-protein interactions imex curation Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Mol. Endocrinol. (0888-8809) 2002 imex curation Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Only protein-protein interactions rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Brendel C., Gelman L., Auwerx J. The interaction occurred in the presence of the ligand of LXR alpha - 10-5 M of 22(R)-hydroxycholesterol. A modified mammalian two-hybrid system was used in which MBF-1 (O60869) was no longer fused to an artificial transactivating domain but experssed as the full-length, wild-type protein. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Endocrinol. (0888-8809) 2002 Only protein-protein interactions imex curation Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Mol. Endocrinol. (0888-8809) 2002 imex curation Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Only protein-protein interactions rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Endocrinol. (0888-8809) 2002 Only protein-protein interactions imex curation Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Mol. Endocrinol. (0888-8809) 2002 imex curation Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Brendel C., Gelman L., Auwerx J. 22(R)-hydroxycholesterol (22(R)-HC)(ligand of LXR-apha) was added at 10-4 M for the pull-down experiment between MBF-1 and LXR-alpha (EBI-781379). Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr auwerx@igbmc.u-strasbg.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Endocrinol. (0888-8809) 2002 Only protein-protein interactions imex curation Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Mol. Endocrinol. (0888-8809) 2002 imex curation Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Only protein-protein interactions rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Brendel C., Gelman L., Auwerx J. cells were grown in the presence of 10-5 M 22(R)-hydroxycholesterol. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Endocrinol. (0888-8809) 2002 Only protein-protein interactions imex curation Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Mol. Endocrinol. (0888-8809) 2002 imex curation Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Only protein-protein interactions in vitro In vitro pull down pull down antibody detection identification by antibody antibody detection Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Endocrinol. (0888-8809) 2002 Only protein-protein interactions imex curation Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. Mol. Endocrinol. (0888-8809) 2002 imex curation Brendel C., Gelman L., Auwerx J. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Only protein-protein interactions in vitro In vitro pull down pull down antibody detection identification by antibody antibody detection Brendel C., Gelman L., Auwerx J. Roislitazone (Rosi) was added at 10-5 M. Figures 3, 4 and 5. auwerx@igbmc.u-strasbg.fr Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Endocrinol. (0888-8809) 2002 Only protein-protein interactions imex curation pparg_human Peroxisome proliferator-activated receptor gamma Nuclear receptor subfamily 1 group C member 3 PPARG NR1C3 protein protein human Homo sapiens Human MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY 3933EFF36A0E4CAF tbp_human TATA-box-binding protein TBP TF2D TFIID GTF2D1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription initiation factor TFIID TBP subunit protein protein human Homo sapiens Human MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT DIP protein P20226 original sequence version: 106 DIP protein P20226 original sequence version: 157 DIP protein P20226 original sequence version: 173 DIP protein P20226 original sequence version: 194 DIP protein P20226 original sequence version: 179 DIP protein P20226 original sequence version: 131 A61A578D972B970B nr1h3_human Oxysterols receptor LXR-alpha Liver X receptor alpha Nuclear receptor subfamily 1 group H member 3 NR1H3 LXRA protein protein human Homo sapiens Human MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE 0D27B237440F8C9C ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH DIP protein Q09472 original sequence version: 193 DIP protein Q09472 original sequence version: 186 DIP protein Q09472 original sequence version: 107 DIP protein Q09472 original sequence version: 112 DIP protein Q09472 original sequence version: 181 DIP protein Q09472 original sequence version: 183 DIP protein Q09472 original sequence version: 136 DIP protein Q09472 original sequence version: 146 DIP protein Q09472 original sequence version: 165 DIP protein Q09472 original sequence version: 192 DIP protein Q09472 original sequence version: 200 DIP protein Q09472 original sequence version: 206 DIP protein Q09472 original sequence version: 194 DIP protein Q09472 original sequence version: 171 DIP protein Q09472 original sequence version: 142 DIP protein Q09472 original sequence version: 180 8E869E1F174A6FEB edf1_human Endothelial differentiation-related factor 1 Multiprotein-bridging factor 1 EDF1 protein protein human Homo sapiens Human MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK ADC2C5384BF85C11 nr5a2_human Nuclear receptor subfamily 5 group A member 2 Alpha-1-fetoprotein transcription factor Hepatocytic transcription factor B1-binding factor CYP7A promoter-binding factor Liver receptor homolog 1 NR5A2 B1F CPF FTF protein protein human Homo sapiens Human MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA 7B07170C075490FE rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT DIP protein P19793 original sequence version: 177 DIP protein P19793 original sequence version: 107 DIP protein P19793 original sequence version: 153 DIP protein P19793 original sequence version: 131 DIP protein P19793 original sequence version: 136 DIP protein P19793 original sequence version: 169 DIP protein P19793 original sequence version: 161 DIP protein P19793 original sequence version: 139 7F952B580AD84C42 edf1-nr5a2-1 1 14 unspecified role unspecified role prey prey ftz-fi box binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Experiments with deletion mutants of LRH-1 found that the DE domain(AA 144-501) was fully dispensable for its interaction with MBF-1. edf1-nr1h3-1 5 11 unspecified role unspecified role prey prey de domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association edf1-pparg-1 8 9 unspecified role unspecified role bait bait de region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-781439]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 507-507, sequence length 505 [EBI-781439]181-507 in vitro In vitro 13 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association The interaction between PPAR-gamma and MBF-1 was not affected by the presence of the synthetic PPAR-gamma ligand rosiglitazone. edf1-rxra-1 1 15 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association pparg-ep300 8 12 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait de domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-781449]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 507-507, sequence length 505 [EBI-781449]181-507 in vitro In vitro physical association physical association edf1-nr5a2-2 1 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined central domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association edf1-nr1h3-2 1 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined central domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association edf1-pparg-2 1 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined central domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association edf1-nr1h3-3 6 11 unspecified role unspecified role prey prey de region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells 13 unspecified role unspecified role bait bait rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells physical association physical association A 2.5-fold induction of luciferase activity was produced. Presence of the ligand 22(R)-hydroxycholesterol was required for the interaction to occur. edf1-pparg-3 4 9 unspecified role unspecified role prey prey de domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-781616]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 507-507, sequence length 505 [EBI-781616]181-507 rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells 13 unspecified role unspecified role bait bait rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells physical association physical association A 10-fold induction of luciferase activity occurred. edf1-nr1h3-4 3 11 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells 13 unspecified role unspecified role bait bait rabit-rk13 rk13 cell line originating from rabbit kidney epithelial cells rk13 RK13 cell line produced from rabbit kidney epithelial cells physical association physical association MBF-1 coactivates the AF-2 function of LXR-alpha - however little enhancement of transcription can be seen in the absence of ligand. edf1-pparg-4 2 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey de domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-781657]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 507-507, sequence length 505 [EBI-781657]181-507 physical association physical association MBF-1 coactivates the AF-2 function of PPAR-gamma - however little enhancement of transcription can be seen in the absence of ligand. tbp-edf1-1 7 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey in vitro In vitro physical association physical association