IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A copper metallochaperone for photosynthesis and respiration reveals metal-specific targets, interaction with an importer, and alternative sites for copper acquisition. A copper metallochaperone for photosynthesis and respiration reveals metal-specific targets, interaction with an importer, and alternative sites for copper acquisition. J. Biol. Chem. (0021-9258) 2002 imex curation Tottey S., Rondet SA., Borrelly GP., Robinson PJ., Rich PR., Robinson NJ. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species interaction detection is : lambda repressor two hybrid MI:0655 when CV update done fig. 2 n.j.robinson@newcastle.ac.uk Only protein-protein interactions ecoli Escherichia coli (strain K12) transcription compl transcriptional complementation assay transcription compl predetermined predetermined participant predetermined Tottey S., Rondet SA., Borrelly GP., Robinson PJ., Rich PR., Robinson NJ. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species interaction detection is : lambda repressor two hybrid MI:0655 when CV update done fig. 2 n.j.robinson@newcastle.ac.uk J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation A copper metallochaperone for photosynthesis and respiration reveals metal-specific targets, interaction with an importer, and alternative sites for copper acquisition. A copper metallochaperone for photosynthesis and respiration reveals metal-specific targets, interaction with an importer, and alternative sites for copper acquisition. J. Biol. Chem. (0021-9258) 2002 imex curation Tottey S., Rondet SA., Borrelly GP., Robinson PJ., Rich PR., Robinson NJ. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species interaction detection is : lambda repressor two hybrid MI:0655 when CV update done fig. 2 n.j.robinson@newcastle.ac.uk Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Tottey S., Rondet SA., Borrelly GP., Robinson PJ., Rich PR., Robinson NJ. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species interaction detection is : lambda repressor two hybrid MI:0655 when CV update done A Q-Sepharose anion exchange matrix is used to confirm the transfert of copper from copper-Atx1 to apoPacS. fig. 2 n.j.robinson@newcastle.ac.uk J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation atcs_syny3 Probable copper-transporting ATPase PacS pacS sll1920 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MAQTINLQLEGMRCAACASSIERAIAKVPGVQSCQVNFALEQAVVSYHGETTPQILTDAVERAGYHARVLKQQVLSSQQTEDRKPVFSAKLVTGLVISAVLFFGSLPMMLGVNIPHFPHIFHDPWLQWLLATPVQFWSGAEFYRGAWKSVRTRSATMDTLVALGTSAAYFYSVAITLFPQWLTSQGLAAHVYFEAAAVVITLILLGRSLEQRARRETSAAIRKLMGLQPQTALVKRGEHWETVAIAELAINDVVRVRPGEKIPVDGVVVAGNSTVDESLVTGESFPVDKTVGTEVIGATLNKSGSLDIQVSKLGQDSVLAQIIQLVQQAQASKAPIQHFVDRITHWFVPTVIVVAIAAFCIWWLTTGNITLAVLTLVEVLIIACPCALGLATPTSVMVGTGKGAEYGVLIKEASSLEMAEKLTAIVLDKTGTLTQGKPSVTNFFTLSPTSTEESLQLIQWAASVEQYSEHPLAEAVVNYGQSQQVSLLEIDNFQAIAGCGVAGQWQGQWIRLGTSNWLTDLGVTGTEHQPWQSQAQQWEKEQKTVIWLAVDTEVKALLAIADAIKPSSPQVVQALKKLGLSVYMLTGDNQATAQAIADTVGIRHVLAQVRPGDKAQQVEQLQQKGNIVAMVGDGINDAPALAQADVGIAIGTGTDVAIAASDITLIAGDLQGILTAIKLSRATMGNIRQNLFFAFIYNVIGIPVAAGLFYPLFGLLLNPILAGAAMAFSSVSVVTNALRLKKFCP DIP protein P73241 original sequence version: 116 40831F66621735FB p74512_syny3 slr1950 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MVQLSPTPASTLTYKDANGQNRTASLTLDVGGMKCAGCVAAVERQLDQLTGVTDSCVNLVTAVAVVRYEPEKIQPQAIAEHLSQRGFPSQIRHGHGAIPATIGEKETRENVNWGLTIALVLLLLSGLGHLSHFGGPMIPFFHHPIFHWSLATLAIAIPGREIFLDGWRGLRFGHANMNTLVALGTGSAYLTSCIAWAWPGLGWECFFDEPVMLLGMLLLGRTLESKARQKAKSALTELLALQPSLARLVGRGEDQGETGIEIPVEQVRVGEWVQVLPGEKIPVDGILVAGKTLVDESLLTGESLPVAKNVDDAVIAGAWNQSGAIIIAATHIGAETTLARIIQLVETAQTQKAPMQRLADQVAGWFAYGVLAIALVTLGFWAMVGQSLFPEMVADTGLSPLLLALKLSVSVLVVACPCALGLATPTAILVGTSLGAEQGILIKGGNILEILQRTTVMAFDKTGTLTQGNLQLTDAVPVADITGIELLTLAASVEQGTRHPLAQGLISSAQGLELLPVENIETEAGQGVQGWYQGDRLLVGNQQWLMEQGVMGEPQWQTAVDQLLDQGKTVIFVARNQQLQGFLALRDTLRPEAKATIAQLKQWGIAPLLLTGDHPAIAQAIAMEVGIEEFQAQMTPQAKVAKIKAMQGFNPVSVIAMVGDGINDAPALAQADVGISLSGATAVAMETADVVLMRSHLSDVLKALTLSRSTVAKIKQNLLWALGYNLLAIPLAAGAFLPSFAIVLTPAIAAAMMASSSIVVVLNALALRYQFSRSLGQDPG 5BC2B2573124708C p73213_syny3 ssr2857 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEVE DIP protein P73213 original sequence version: 101 111676DBB03D032E pacs-ssr2857-2 1 3 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey P73213:p.[Cys12Ser;Cys15Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:38:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys12ser,cys15ser' Tue Jun 30 17:13:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys12Ser;Cys15Ser]' physical association physical association Atx1 Interacts with the Amino-terminal Region of PacS in a Bacterial Two-hybrid Assay. slr1950-ssr2857-2 1 4 unspecified role unspecified role bait bait n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey physical association physical association Atx1 Interacts with the Amino-terminal Region of CtaA in a Bacterial Two-hybrid Assay ssr2857-slr1950-1 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 5 enzyme enzyme unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Following co-incubation of two further, similar aliquots of the same preparations of apoPacSN and copper-Atx1, the amount of copper associated with Atx1 declined and, most importantly, copper became associated with apoPacSN. P73213 purified P74512 purified revist when new CV interaction type 'ion exchange'