UniProt UniProt http://www.uniprot.org Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Mol. Cell (1097-2765) 2001 imex curation Calvo O., Manley JL. GST-SUB1/PC4has been incubated with human HeLa cell nuclear extract. jlm2@columbia.edu 25-OCT-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Calvo O., Manley JL. GST-SUB1/PC4has been incubated with human HeLa cell nuclear extract. jlm2@columbia.edu Accepted 2006-SEP-19 by DAVET. 25-OCT-2006: Contacted by JYOTI. Mol. Cell (1097-2765) 2001 Only protein-protein interactions imex curation Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Mol. Cell (1097-2765) 2001 imex curation Calvo O., Manley JL. GST-SUB1/PC4has been incubated with human HeLa cell nuclear extract. jlm2@columbia.edu 25-OCT-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Calvo O., Manley JL. His-tagged SUB1 bound to Ni2+-NTA-agarose beads was incubated with GST- RNA15FL (full length) GST-RNA15CT (C-terminus) constructs. Supernatants were analyzed by SDS-PAGE and immunobloting with anti-RNA15 antibody. Association has been tested with RNase treatment. jlm2@columbia.edu Accepted 2006-SEP-18 by DAVET. Mol. Cell (1097-2765) 2001 Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Mol. Cell (1097-2765) 2001 imex curation Calvo O., Manley JL. GST-SUB1/PC4has been incubated with human HeLa cell nuclear extract. jlm2@columbia.edu 25-OCT-2006: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Calvo O., Manley JL. GST-SUB1/PC4has been incubated with human HeLa cell nuclear extract. jlm2@columbia.edu Accepted 2006-SEP-19 by DAVET. 25-OCT-2006: Contacted by JYOTI. Mol. Cell (1097-2765) 2001 Only protein-protein interactions imex curation Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Mol. Cell (1097-2765) 2001 imex curation Calvo O., Manley JL. GST-SUB1/PC4has been incubated with human HeLa cell nuclear extract. jlm2@columbia.edu 25-OCT-2006: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Calvo O., Manley JL. GST-SUB1/PC4has been incubated with human HeLa cell nuclear extract. jlm2@columbia.edu Accepted 2006-SEP-19 by DAVET. 25-OCT-2006: Contacted by JYOTI. human fetal brain cDNA library Mol. Cell (1097-2765) 2001 Only protein-protein interactions imex curation Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Evolutionarily conserved interaction between CstF-64 and PC4 links transcription, polyadenylation, and termination. Mol. Cell (1097-2765) 2001 imex curation Calvo O., Manley JL. GST-SUB1/PC4has been incubated with human HeLa cell nuclear extract. jlm2@columbia.edu 25-OCT-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Calvo O., Manley JL. His-tagged SUB1 bound to Ni2+-NTA-agarose beads was incubated with total cell extracts from wild-type, rna15-1, and rna15-2 strains. Supernatants were analyzed by SDS-PAGE and immunobloting with anti-RNA15 antibody. Association has been tested with RNase treatment. jlm2@columbia.edu Accepted 2006-SEP-18 by DAVET. Mol. Cell (1097-2765) 2001 p33240-1 Cleavage stimulation factor subunit 2 CSTF2 CF-1 64 kDa subunit Cleavage stimulation factor 64 kDa subunit protein protein human Homo sapiens Human MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQAQVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAMEARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINMGAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP B76595E9BF8FABBD sub1_yeast RNA polymerase II transcriptional coactivator SUB1 SUB1 TSP1 YMR039C YM9532.04C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYYNRYRNKRRSDNGGGNLSNSNNNNGGMPSGLSASDAIFDLGKNKRVTVRQFRNINLIDIREYYLDSSTGEMKPGKKGISLTEDLYDELLKHRLNIDEALRRLGSKRPKTKMVRLLSDDEYEDDNNNDSTNNDKDKNGKDKNSPKKRREDKSKASNESHDLEPRSKKKKPAPPTLLPHEENIQNAEREANATLIIPGQAGRKQQEERKQKEKEEAEEAKAKAVAEQEKEAKAKEKIAEPEPEPVPTLQAKKEDIVSNINESKDANSSDEEFAQSLEAEMNKAEDDISEEE 1E278C3EF2D569C8 rna15_yeast mRNA 3'-end-processing protein RNA15 YGL044C RNA15 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNRQSGVNAGVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSDISGVSQQQQQQYNNINGNNNNNGNNNNNSNGPDFQNSGNANFLSQKFPELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQEWTRAHPEDAVSLLELCPQLSFVTAELLLTNGICKVDDLIPLASRPQEEASATNNNSVNEVVDPAVLNKQKELLKQVLQLNDSQISILPDDERMAIWDLKQKALRGEFGAF 10053B8648A71ECB 10053B8648A71ECB tcp4_human Activated RNA polymerase II transcriptional coactivator p15 SUB1 homolog Positive cofactor 4 p14 SUB1 PC4 RPO2TC1 protein protein human Homo sapiens Human MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL DIP protein P53999 original sequence version: 60 0DAE0CAAAD5E4E15 cstf2_human Cleavage stimulation factor subunit 2 CSTF2 CF-1 64 kDa subunit Cleavage stimulation factor 64 kDa subunit protein protein human Homo sapiens Human MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQAQVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAMEARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINMGAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP DIP protein P33240 original sequence version: 134 DIP protein P33240 original sequence version: 108 B76595E9BF8FABBD sub1-cstf2-1 1 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association 1B cstf2-sub1-1 4 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association 1A sub1-cstf2-2 3 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1C cstf2-sub1-3 3 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1D sub1-rna15-1 2 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Interactions were resistent to RNase A treatment. 2C sub1-rna15-2 5 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey physical association physical association 5B Interaction was enhanced in mutant rna15-1 in which a leucine residue is replaced by a proline in the C-terminal domain (not further specified).