IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Oligomeric structures of poliovirus polymerase are important for function. Oligomeric structures of poliovirus polymerase are important for function. EMBO J. (0261-4189) 2001 imex curation Hobson SD., Rosenblum ES., Richards OC., Richmond K., Kirkegaard K., Schultz SC. RNA binding was evaluated using a nitrocellulose filter binding assay. The amount of radiolabelled RNA bound to each membrane was quantified using a PhosphorImager Residues renumbered to match full-length polyprotein for this virus. scott.hobson@cellzome.de 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions in vitro In vitro rna rna pol assay rna directed rna polymerase assay rna rna pol assay predetermined predetermined participant predetermined Hobson SD., Rosenblum ES., Richards OC., Richmond K., Kirkegaard K., Schultz SC. RNA binding was evaluated using a nitrocellulose filter binding assay. The amount of radiolabelled RNA bound to each membrane was quantified using a PhosphorImager Residues renumbered to match full-length polyprotein for this virus. scott.hobson@cellzome.de Accepted 2006-AUG-24 by DAVET. 13-SEP-2006: Contacted by JYOTI EMBO J. (0261-4189) 2001 Only protein-protein interactions imex curation Oligomeric structures of poliovirus polymerase are important for function. Oligomeric structures of poliovirus polymerase are important for function. EMBO J. (0261-4189) 2001 imex curation Hobson SD., Rosenblum ES., Richards OC., Richmond K., Kirkegaard K., Schultz SC. RNA binding was evaluated using a nitrocellulose filter binding assay. The amount of radiolabelled RNA bound to each membrane was quantified using a PhosphorImager Residues renumbered to match full-length polyprotein for this virus. scott.hobson@cellzome.de 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Hobson SD., Rosenblum ES., Richards OC., Richmond K., Kirkegaard K., Schultz SC. RNA binding was evaluated using a nitrocellulose filter binding assay. The amount of radiolabelled RNA bound to each membrane was quantified using a PhosphorImager Residues renumbered to match full-length polyprotein for this virus. scott.hobson@cellzome.de Accepted 2006-AUG-24 by DAVET. 13-SEP-2006: Contacted by JYOTI EMBO J. (0261-4189) 2001 Only protein-protein interactions imex curation Oligomeric structures of poliovirus polymerase are important for function. Oligomeric structures of poliovirus polymerase are important for function. EMBO J. (0261-4189) 2001 imex curation Hobson SD., Rosenblum ES., Richards OC., Richmond K., Kirkegaard K., Schultz SC. RNA binding was evaluated using a nitrocellulose filter binding assay. The amount of radiolabelled RNA bound to each membrane was quantified using a PhosphorImager Residues renumbered to match full-length polyprotein for this virus. scott.hobson@cellzome.de 13-SEP-2006: Contacted by JYOTI Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Hobson SD., Rosenblum ES., Richards OC., Richmond K., Kirkegaard K., Schultz SC. RNA binding was evaluated using a nitrocellulose filter binding assay. The amount of radiolabelled RNA bound to each membrane was quantified using a PhosphorImager Residues renumbered to match full-length polyprotein for this virus. scott.hobson@cellzome.de Accepted 2006-AUG-24 by DAVET. 13-SEP-2006: Contacted by JYOTI EMBO J. (0261-4189) 2001 Only protein-protein interactions imex curation ccgucgacguacgucgacgg 3' - 5' RNA strand synthesised for use in PMID: 11230138 rna ribonucleic acid RNA rna in vitro In vitro CCGUCGACGUACGUCGACGG 9D99223E3031F2D1 p03300-pro_0000040090 RNA-directed RNA polymerase peptide peptide polypeptide oligopeptide oligopeptide polypeptide pol1m Poliovirus type 1 (strain Mahoney) GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALLLPEYSTLYRRWLDSF 1749 2209 EB8BD8DAF1A96438 zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ggcgcggcagcugcaugcag 5'-3' RNA synthesized for use in PMID: 11230138 rna ribonucleic acid RNA rna in vitro In vitro GGCGCGGCAGCUGCAUGCAGCUGCC 09042C083EF05694 ggcagcugcaugcagcugcc 5' -3' RNA synthesized for use in PMID: 11230138 rna ribonucleic acid RNA rna in vitro In vitro GGCAGCUGCAUGCAGCUGCC 2D471B084A326E06 ccgucgacguacgucgac-2 3'-5' RNA strand synthesised for use in PMID: 11230138 rna ribonucleic acid RNA rna in vitro In vitro CGUCGACGUACGUCGACGGCGCGG 0A412192B0FD9922 polg-rna-1 3 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait P03300-PRO_0000040090:p.Leu342Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:25:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu343ala' Thu Mar 05 22:59:40 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu343Ala' Tue Jun 30 19:45:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu342Ala' P03300-PRO_0000040090:p.Lys348Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 19:46:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys349arg' Thu Mar 05 22:54:39 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys349Arg' Tue Jun 30 16:48:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys348Arg' P03300-PRO_0000040090:p.Arg455Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D Wed May 02 19:47:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg456asp' Thu Mar 05 23:06:33 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg456Asp' Tue Jun 30 16:53:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg455Asp' P03300-PRO_0000040090:p.Arg456Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D Wed May 02 18:11:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg457asp' Thu Mar 05 23:03:13 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg457Asp' Tue Jun 30 16:18:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg456Asp' ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey direct interaction direct interaction ED50 (wild-type)=3x10exp-6M RNA strands bind to form a blunt ended double strand, authors name 0.20 RNA 2A, 2C the blunt end 0.20 RNA and the 5′-extended 5.20 RNA have nearly identical affinities for the polymerase Protein bound single stranded RNA's with approximately 10 fold lower affinity. polg-rna-2 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait P03300-PRO_0000040090:p.Lys348Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 18:16:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys349arg' Thu Mar 05 23:32:52 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys349Arg' Tue Jun 30 17:53:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys348Arg' P03300-PRO_0000040090:p.Tyr454Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y D Wed May 02 18:18:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr455asp' Thu Mar 05 23:21:33 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr455Asp' Tue Jun 30 18:05:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr454Asp' P03300-PRO_0000040090:p.Arg455Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D Wed May 02 18:19:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg456asp' Thu Mar 05 22:48:12 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg456Asp' Tue Jun 30 15:43:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg455Asp' P03300-PRO_0000040090:p.Ser341Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:51:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser342ala' Thu Mar 05 22:18:41 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser342Ala' Tue Jun 30 18:47:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser341Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role prey prey direct interaction direct interaction ED50 (wild-type)=6x10exp-6M RNA strands bind to form a blunt ended double strand, authors name 5.20 RNA 2A, 2D the blunt end 0.20 RNA and the 5′-extended 5.20 RNA have nearly identical affinities for the polymerase Protein bound single stranded RNA's with approximately 10 fold lower affinity. polg-rna-3 1 7 enzyme target enzyme target substrate substrate unspecified role unspecified role 5 enzyme enzyme unspecified role unspecified role region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P03300-PRO_0000040090:p.[Leu446Ala;Arg455Asp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain R D Wed May 02 17:10:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro28cys' Wed Jul 11 12:59:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu446Ala;Arg455Asp]' Thu Mar 05 23:05:11 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu447Ala;Arg456Asp]' Tue Jun 30 16:05:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu446Ala;Arg455Asp]' P03300-PRO_0000040090:p.Arg455_Arg456delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain RR AA Wed Jul 11 13:36:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg455Ala;Arg456Ala]' Thu Mar 05 22:02:50 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg456_Arg457delinsAlaAla' Tue Jun 30 16:22:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg455_Arg456delinsAlaAla' P03300-PRO_0000040090:p.Ile441Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I C Wed May 02 19:10:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro441cys' Thu Mar 05 23:27:46 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile442Cys' Tue Jun 30 18:26:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile441Cys' P03300-PRO_0000040090:p.Leu342Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:54:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile442leu' Thu Mar 05 23:06:14 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu343Ala' Tue Jun 30 17:11:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu342Ala' P03300-PRO_0000040090:p.Asp349Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D R Wed May 02 20:19:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys349arg' Thu Mar 05 22:36:00 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp350Arg' Tue Jun 30 19:05:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp349Arg' P03300-PRO_0000040090:p.Arg455Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D Wed May 02 16:33:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr455asp' Thu Mar 05 22:56:33 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg456Asp' Tue Jun 30 20:14:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg455Asp' P03300-PRO_0000040090:p.Arg456Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D Wed May 02 16:17:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg456asp' Thu Mar 05 22:17:16 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg457Asp' Tue Jun 30 19:29:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg456Asp' ecobb Escherichia coli (strain B / BL21) 9 enzyme target enzyme target substrate substrate unspecified role unspecified role 6 cofactor cofactor coenzyme unspecified role unspecified role dna elongation dna strand elongation DNA replication elongation dna elongation Figure 2F and Figure 3 RNA strands bind to form a blunt ended double stranded RNA, authors name 5.20 RNA polg-polg-1 2 5 unspecified role unspecified role neutral component neutral component P03300-PRO_0000040090:p.Ile441Cys mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I C Wed May 02 14:46:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile442cys' Thu Mar 05 22:30:46 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile442Cys' Tue Jun 30 19:38:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile441Cys' ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role neutral component neutral component P03300-PRO_0000040090:p.Ala29Cys mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A C Wed May 02 15:37:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala30cys' Thu Mar 05 23:04:07 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala30Cys' Tue Jun 30 17:18:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala29Cys' ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 6E In the mixture of A29C and I441C mutant proteins, however (Figure 6E, lane 12), a discrete dimer-length product was observed Under reducing conditions, only protein monomers are observed.