IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. Plant Cell (1040-4651) 1999 imex curation Gindullis F., Peffer NJ., Meier I. meieri@ esvax.dnet.dupont.com 15-NOV-2006: Contacted by JYOTI. Tomato leaf cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gindullis F., Peffer NJ., Meier I. meieri@ esvax.dnet.dupont.com Accepted 2006-NOV-9 by JYOTI. 15-NOV-2006: Contacted by JYOTI. Tomato leaf cDNA library Plant Cell (1040-4651) 1999 Only protein-protein interactions imex curation MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. Plant Cell (1040-4651) 1999 imex curation Gindullis F., Peffer NJ., Meier I. meieri@ esvax.dnet.dupont.com 15-NOV-2006: Contacted by JYOTI. Tomato leaf cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gindullis F., Peffer NJ., Meier I. meieri@ esvax.dnet.dupont.com Accepted 2006-NOV-9 by JYOTI. 15-NOV-2006: Contacted by JYOTI. Tomato leaf cDNA library Plant Cell (1040-4651) 1999 Only protein-protein interactions imex curation MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. Plant Cell (1040-4651) 1999 imex curation Gindullis F., Peffer NJ., Meier I. meieri@ esvax.dnet.dupont.com 15-NOV-2006: Contacted by JYOTI. Tomato leaf cDNA library Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting antibody detection identification by antibody antibody detection Gindullis F., Peffer NJ., Meier I. meieri@ esvax.dnet.dupont.com Accepted 2006-NOV-9 by JYOTI. 15-NOV-2006: Contacted by JYOTI. Tomato leaf cDNA library Plant Cell (1040-4651) 1999 Only protein-protein interactions imex curation maf1_sollc MFP1 attachment factor 1 MAF1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MAEIDSAQSQETVTQETQNKPMTTSFSIWPPTQRTRDAVINRLIESLSTPSILSKRYGTLPQDEASETARLIEEEAFAAAGSTASDADDGIEILQVYSKEISKRMIDTVKSRSAPAAASEGESKPSELPADASEPSSASGLTGEVSSVETEP 313E1FE7333CD08D mfp1_sollc MAR-binding filament-like protein 1 MFP1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MATSCFPPFSASSSSLCSSQFTPLLSCPRNTQICRKKRPVMASMHSENQKESNVCNRRSILFVGFSVLPLLNLRARALEGLSTDSQAQPQKEETEQTIQGSAGNPFVSLLNGLGVVGSGVLGSLYALARNEKAVSDATIESMKNKLKDKEDAFVSMKKQFESELLSEREDRNKLIRREGEERQALVNQLKSAKTTVISLGQELQNEKKLAEDLKFEIKGLQNDLMNTKEDKKKLQEELKEKLDLIQVLEEKITLLTTEIKDKEVSLRSNTSKLAEKESEVNSLSDMYQQSQDQLMNLTSEIKELKDEIQKRERELELKCVSEDNLNVQLNSLLLERDESKKELHAIQKEYSEFKSNSDEKVASDATLGEQEKRLHQLEEQLGTALSEASKNEVLIADLTREKENLRRMVDAELDNVNKLKQEIEVTQESLENSRSEVSDITVQLEQLRDLSSKLEREVSKLQMELEETRASLQRNIDETKHSSELLAAELTTTKELLKKTNEEMHTMSDELVAVSENRDSLQTELVNVYKKREHTRNELKQEKTIVRTLEEELKFLESQITREKELRKSLEDELEKATESLDEINRNVLALAEELELATSRNSSLEDEREVHRQSVSEQKQISQEAQENLEDAHSLVMKLGKERESLEKRAKKLEDEMAAAKGEILRLRSQINSVKAPVEDEEKVVAGEKEKVNVQQ 700A56D68D6A7E49 mfp1-maf1 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A Sequencing of the inserts showed that the three cDNAs encoded an identical protein sequence in frame with the GAL4 DNA binding domain. The deduced protein was named MAF1 (for MFP1 associated factor 1). mfp1-maf1-1 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1D Only the positivecontrol pair and the combination of pBD�HHMFP1 and pAD21-1 gave rise to colonies growing on Leu 2 , Trp 2 , and His 2 plates, maf1-mfp1 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1D Only the positivecontrol pair and the combination of pBD�HHMFP1 and pAD21-1 gave rise to colonies growing on Leu 2 , Trp 2 , and His 2 plates, mfp1-maf1-2 3 4 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1112574]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 717-717, sequence length 697 [EBI-1112574]126-717 trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction 1E Confirmation of the MFP1�MAF1 interaction by protein overlay analysis. The UniProt entry for protein MFP1 is 697 amino acids in length. The construct used in the paper reports thet the MFP1 protein consisted of residues 126 to 717 amino acids. The UniProt protein sequence was used to delimit the binding region of MFP1 to MAF1.