MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it G protein-coupled receptor kinase 6A phosphorylates the Na(+)/H(+) exchanger regulatory factor via a PDZ domain-mediated interaction. G protein-coupled receptor kinase 6A phosphorylates the Na(+)/H(+) exchanger regulatory factor via a PDZ domain-mediated interaction. J. Biol. Chem. (0021-9258) 1999 Hall RA., Spurney RF., Premont RT., Rahman N., Blitzer JT., Pitcher JA., Lefkowitz RJ. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Hall RA., Spurney RF., Premont RT., Rahman N., Blitzer JT., Pitcher JA., Lefkowitz RJ. J. Biol. Chem. (0021-9258) 1999 G protein-coupled receptor kinase 6A phosphorylates the Na(+)/H(+) exchanger regulatory factor via a PDZ domain-mediated interaction. G protein-coupled receptor kinase 6A phosphorylates the Na(+)/H(+) exchanger regulatory factor via a PDZ domain-mediated interaction. J. Biol. Chem. (0021-9258) 1999 Hall RA., Spurney RF., Premont RT., Rahman N., Blitzer JT., Pitcher JA., Lefkowitz RJ. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hall RA., Spurney RF., Premont RT., Rahman N., Blitzer JT., Pitcher JA., Lefkowitz RJ. J. Biol. Chem. (0021-9258) 1999 G protein-coupled receptor kinase 6A phosphorylates the Na(+)/H(+) exchanger regulatory factor via a PDZ domain-mediated interaction. G protein-coupled receptor kinase 6A phosphorylates the Na(+)/H(+) exchanger regulatory factor via a PDZ domain-mediated interaction. J. Biol. Chem. (0021-9258) 1999 Hall RA., Spurney RF., Premont RT., Rahman N., Blitzer JT., Pitcher JA., Lefkowitz RJ. in vitro In vitro protein kinase assay protein kinase assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hall RA., Spurney RF., Premont RT., Rahman N., Blitzer JT., Pitcher JA., Lefkowitz RJ. J. Biol. Chem. (0021-9258) 1999 G protein-coupled receptor kinase 6A phosphorylates the Na(+)/H(+) exchanger regulatory factor via a PDZ domain-mediated interaction. G protein-coupled receptor kinase 6A phosphorylates the Na(+)/H(+) exchanger regulatory factor via a PDZ domain-mediated interaction. J. Biol. Chem. (0021-9258) 1999 Hall RA., Spurney RF., Premont RT., Rahman N., Blitzer JT., Pitcher JA., Lefkowitz RJ. in vitro In vitro saturation binding saturation binding nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hall RA., Spurney RF., Premont RT., Rahman N., Blitzer JT., Pitcher JA., Lefkowitz RJ. J. Biol. Chem. (0021-9258) 1999 grk2_caeel G protein-coupled receptor kinase 2 grk-2 W02B3.2 protein protein caeel Caenorhabditis elegans MADLEAVLADVSYLMAMEKSRSQPAARASKRIVLPDPSVRSIMQKFLEKSGDMKFDKIFNQKLGFLLLKDYAENVSESPCPQIKFYEAIKEYEKMETPDERLTKAREIYDHHIMVEMLAHAHNYSKESLQHVQYHLLKQNVPPDLFHRYVLEICDQLRGDIFQRFLESDKFTRFCQWKNLELNMQLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGQDCPFIVCMTYAFQSPDKLCFILDLMNGGDLHYHLSQHGVFTEQEMIFYASEVILGLEHMHNRFVVYRDLKPANILLDENGHVRVSDLGLACDYSKKKPHASVGTHGYMAPEVLAKGVAYDSSADWFSLGCMLYKLLKGHSPFRQHKSKDKNEIDKMTLTQDIELPNEGLSKDCRDLLEGLLKRDVPDRLGCRGKGPTEVKEHPFFKDVDWQTVYLRRMTPPLIPPRGEVNAADAFDIGNFDDDEVKGVKLQDGDSDLYKNFNIVISERWQNEIAETIFEVVNQDADKAESKKRSKQKIKVAVEEKDSDVIVHGYIKKLGGPFTSAWQTKYGKLYPSRLELYPESLTAKPELVFMDQIEDVCAEMQTIKGETAIIVKLRDGFKEPKICLTNSDEISLKEWHTSLRTAHKVSQELLQRMGRKAIKIYGVNHDPMLSESERPGSVTRAFLNRASSVDSGV mint Specifically phosphorylates the activated forms of G protein-coupled receptors D37F03260F324939 nhrf1_rabit Na(+)/H(+) exchange regulatory cofactor NHE-RF1 SLC9A3R1 NHERF NHERF1 Ezrin-radixin-moesin-binding phosphoprotein 50 Regulatory cofactor of Na(+)/H(+) exchanger Sodium-hydrogen exchanger regulatory factor 1 Solute carrier family 9 isoform A3 regulatory factor 1 protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKVGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPDTDEQFRKLGVQIRGELLRAQAGPEQAGPPAAPGEQGPAGENEPREVEKSHPERRELRPRLCAMKKGPNGYGFNLHSDKSRPGQFIRAVDPDSPAEASGLREQDRIVEVNGVCVEGKQHGDVVTAIKAGGDEAKLLVVDKETDEFFKKCKVVPSSEHLNGPLPEPFTNGEIQKNNPETLAPAASESPRPALARSASSDTSEELASQDSPKKEDSTAPSSTSSSSDPILDFSISLAVAKERAHQKRSSRRAPQMDWSEKKELFSNL Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for recycling of internalized ADRB2. Was first known to play a role in the regulation of the activity and subcellular location of SLC9A3. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May enhance Wnt signaling. May participate in HTR4 targeting to microvilli mint F55E6D6FFA01B991 opsd_mouse Rhodopsin Rho protein protein mouse Mus musculus Mouse MNGTEGPNFYVPFSNVTGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVVFTWIMALACAAPPLVGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIFFLICWLPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSIYNPVIYIMLNKQFRNCMLTTLCCGKNPLGDDDASATASKTETSQVAPA Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal mint B336C04B699AFF75 o70293-1 G protein-coupled receptor kinase 6 Grk6 G protein-coupled receptor kinase GRK6 Gprk6 protein protein mouse Mus musculus Mouse MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQPIGRLLFREFCATRPELTRCTAFLDGVSEYEVTPDEKRKACGRRLMQNFLSHTGPDLIPEVPRQLVSNCAQRLEQGPCKDLFQELTRLTHEYLSTAPFADYLDSIYFNRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLEDLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVRNERYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVAEEYTDRFSSQARSLCSQLLSKDPAERLGCRGGGAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDIEQFSTVKGVDLEPTDQDFYQKFATGSVSIPWQNEMVETECFQELNVFGLDGSVPPDLDWKGQPTAPPKKGLLQRLFSRQDCCGNCSDSEEELPTRL mint 91EEC2028CAF4B91 adrb2_mouse Beta-2 adrenergic receptor Beta-2 adrenoreceptor Adrb2 Adrb2r protein protein mouse Mus musculus Mouse MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAKFERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKKAIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRDNLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNGRTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTVPSLSVDSQGRNCSTNDSPL DIP protein P18762 original sequence version: 145 DIP protein P18762 original sequence version: 147 This sequence has been withdrawn from Uniprot. 51D1EC73D7619D58 grk6-slc9a3r1 4 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1793238: original sequence: 1-151 : MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKVGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPDTDEQFRKLGVQIRGELLRAQAGPEQAGPPAAPGEQGPAGENEPREVEKSHPERREL Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-1793245: original sequence: 559-576 : QDCCGNCSDSEEELPTR Stoichiometry: 1.0 direct interaction direct interaction F2D kd 31 nanomolar mint slc9a3r1-grk6 1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F2E mint grk6-slc9a3r1-1 2 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1795021: original sequence: 1-151 : MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKVGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPDTDEQFRKLGVQIRGELLRAQAGPEQAGPPAAPGEQGPAGENEPREVEKSHPERREL tagged molecule tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F2B mint adrb2-slc9a3r1 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1793188: original sequence: 1-151 : MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKVGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPDTDEQFRKLGVQIRGELLRAQAGPEQAGPPAAPGEQGPAGENEPREVEKSHPERREL Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-1793195: original sequence: 401-418 : SLSVDSQGRNCSTNDSP gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F2C mint grk6-slc9a3r1-2 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q28619:p.Lys159Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:18:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:19:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys159ala' Tue Jun 30 18:13:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys159Ala' range MINT-1793375: original sequence: 159-159 : ELRPRLCAMKKGPNGYGFNL binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1793355: original sequence: 152-357 : PRLCAMKKGPNGYGFNLHSDKSRPGQFIRAVDPDSPAEASGLREQDRIVEVNGVCVEGKQHGDVVTAIKAGGDEAKLLVVDKETDEFFKKCKVVPSSEHLNGPLPEPFTNGEIQKNNPETLAPAASESPRPALARSASSDTSEELASQDSPKKEDSTAPSSTSSSSDPILDFSISLAVAKERAHQKRSSRRAPQMDWSEKKELFS Q28619:p.Lys158Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:19:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:56:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys158ala' Tue Jun 30 15:40:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys158Ala' range MINT-1793377: original sequence: 158-158 : RELRPRLCAMKKGPNGYGFN Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1793372: original sequence: 559-576 : QDCCGNCSDSEEELPTR Stoichiometry: 1.0 direct interaction direct interaction F4A mint grk6-slc9a3r1-3 3 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tagged his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1795156: original sequence: 152-357 : PRLCAMKKGPNGYGFNLHSDKSRPGQFIRAVDPDSPAEASGLREQDRIVEVNGVCVEGKQHGDVVTAIKAGGDEAKLLVVDKETDEFFKKCKVVPSSEHLNGPLPEPFTNGEIQKNNPETLAPAASESPRPALARSASSDTSEELASQDSPKKEDSTAPSSTSSSSDPILDFSISLAVAKERAHQKRSSRRAPQMDWSEKKELFS Q28619:p.Ser289Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:56:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:34:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser289ala' Tue Jun 30 18:29:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser289Ala' range MINT-1793326: original sequence: 289-289 : SPRPALARSASSDTSEELAS Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation F3A F3C F3D mint grk6-rho 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation F3B homomint mint grk_2-rho 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation F3B homomint mint