IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A bioluminescence resonance energy transfer (BRET) system: application to interacting circadian clock proteins. A bioluminescence resonance energy transfer (BRET) system: application to interacting circadian clock proteins. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Xu Y., Piston DW., Johnson CH. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species carl.h.johnson@vanderbilt.edu Department of Biology, Box 1812-B, Vanderbilt University, Nashville, TN 37235 in vitro In vitro bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined Xu Y., Piston DW., Johnson CH. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species carl.h.johnson@vanderbilt.edu Department of Biology, Box 1812-B, Vanderbilt University, Nashville, TN 37235 Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 A bioluminescence resonance energy transfer (BRET) system: application to interacting circadian clock proteins. A bioluminescence resonance energy transfer (BRET) system: application to interacting circadian clock proteins. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Xu Y., Piston DW., Johnson CH. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species carl.h.johnson@vanderbilt.edu Department of Biology, Box 1812-B, Vanderbilt University, Nashville, TN 37235 ecoli Escherichia coli (strain K12) bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined Xu Y., Piston DW., Johnson CH. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species 2B carl.h.johnson@vanderbilt.edu Department of Biology, Box 1812-B, Vanderbilt University, Nashville, TN 37235 Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 kaib_syne7 Circadian clock protein KaiB kaiB see0010 Synpcc7942_1217 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MSPRKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF DIP protein Q79PF5 original sequence version: 53 DIP protein Q79PF5 original sequence version: 78 4E7FD086742A398F kaia_syne7 Circadian clock protein KaiA see0009 kaiA Synpcc7942_1218 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQIDCLILVAANPSFRAVVQQLCFEGVVVPAIVVGDRDSEDPDEPAKEQLYHSAELHLGIHQLEQLPYQVDAALAEFLRLAPVETMADHIMLMGANHDPELSSQQRDLAQRLQERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYREIVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELMDEFAKKLRVEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRET DIP protein Q79PF6 original sequence version: 52 DIP protein Q79PF6 original sequence version: 58 DIP protein Q79PF6 original sequence version: 81 7C4F3B79FFDF59A2 kaib-kaib-1 1 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 3 unspecified role unspecified role fluorescence donor fluorescence donor n terminal renilla luciferase fusion protein fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction kaib-kaib-3 2 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role fluorescence donor fluorescence donor n terminal renilla luciferase fusion protein fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction kaib-kaia-9 2 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 unspecified role unspecified role fluorescence donor fluorescence donor n terminal renilla luciferase fusion protein fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction