DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structures of Cdc42 bound to the active and catalytically compromised forms of Cdc42GAP. Structures of Cdc42 bound to the active and catalytically compromised forms of Cdc42GAP. Nat. Struct. Biol. (1072-8368) 1998 imex curation Nassar N., Hoffman GR., Manor D., Clardy JC., Cerione RA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nassar N., Hoffman GR., Manor D., Clardy JC., Cerione RA. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nat. Struct. Biol. (1072-8368) 1998 IMEx rhg01_human Rho GTPase-activating protein 1 Rho-type GTPase-activating protein 1 Rho-related small GTPase protein activator p50-RhoGAP CDC42 GTPase-activating protein ARHGAP1 CDC42GAP RHOGAP1 GTPase-activating protein rhoGAP protein protein human Homo sapiens Human MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL DIP protein Q07960 original sequence version: 165 DIP protein Q07960 original sequence version: 155 4DD0CC4419849C35 p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60953-2 original sequence version: 152 DIP protein P60953 original sequence version: 98 DIP protein P60953 original sequence version: 148 DIP protein P60953 original sequence version: 142 DIP protein P60953-2 original sequence version: 135 DIP protein P60953 original sequence version: 99 DIP protein P60953-2 original sequence version: 139 DIP protein P60953 original sequence version: 144 DIP protein P60953 original sequence version: 163 DIP protein P60953 original sequence version: 158 DIP protein P60953-2 original sequence version: 147 DIP protein P60953 original sequence version: 123 51A437E22A4D8FFF cdc42-arggap1-1 1 2 unspecified role unspecified role neutral component neutral component rhogap binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 2.10A working 21.1%, free 25.9% contains aluminium fluoride (AlF3), Magnesium and GDP cdc42-arggap1-2 1 3 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component rhogap binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q07960:p.Arg291Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:36:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg291ala' Tue Jun 30 16:58:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg291Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1.90A working 25.3%, free 29.3% contains aluminium fluoride (AlF3), Magnesium and GDP R292A is called R305A by the authors The mutation of the arginine finger does not prevent the formation of the complex but the GAP activity is compromised.