IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. Mol. Cell (1097-2765) 1998 Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip polyclonal western polyclonal antibody western blot polyclonal western Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. Mol. Cell (1097-2765) 1998 Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email in vitro In vitro pull down pull down predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. Mol. Cell (1097-2765) 1998 Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email in vitro In vitro pull down pull down predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. Mol. Cell (1097-2765) 1998 Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email in vitro In vitro pull down pull down predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. Mol. Cell (1097-2765) 1998 Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email in vitro In vitro pull down pull down predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. Mol. Cell (1097-2765) 1998 Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. Mol. Cell (1097-2765) 1998 Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email Mol. Cell (1097-2765) 1998 SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. SAP30, a component of the mSin3 corepressor complex involved in N-CoR-mediated repression by specific transcription factors. Mol. Cell (1097-2765) 1998 Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Laherty CD., Billin AN., Lavinsky RM., Yochum GS., Bush AC., Sun JM., Mullen TM., Davie JR., Rose DW., Glass CK., Rosenfeld MG., Ayer DE., Eisenman RN. Two immunoprecipitations from [35-S]methionine-labelled U937 cells were done: (1) anti-Sin3a and (2) anti-Sap30. The specificity of the antibody for the Sin3a was checked in control experiments by the addition pf a block cognate immunogen (GST-PAH2 fragment of Sin3a). Fig 2A no email library of mouse embryo cDNA's used Mol. Cell (1097-2765) 1998 sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q60520 original sequence version: 144 DIP protein Q60520 original sequence version: 106 DIP protein Q60520 original sequence version: 115 DIP protein Q60520 original sequence version: 158 80FE378F62ED7CB3 ncor1_mouse Nuclear receptor corepressor 1 Ncor1 Rxrip13 Retinoid X receptor-interacting protein 13 protein protein mouse Mus musculus Mouse MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD DIP protein Q60974 original sequence version: 149 DIP protein Q60974 original sequence version: 144 DIP protein Q60974 original sequence version: 110 DIP protein Q60974 original sequence version: 92 DIP protein Q60974-1 original sequence version: 110 DIP protein Q60974 original sequence version: 161 DIP protein Q60974 original sequence version: 131 52208B40382F7E6A hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP DIP protein P70288 original sequence version: 83 DIP protein P70288 original sequence version: 123 DIP protein P70288 original sequence version: 112 DIP protein P70288 original sequence version: 99 DIP protein P70288 original sequence version: 155 DIP protein P70288 original sequence version: 117 B9843D24A775157C sin3b_mouse Paired amphipathic helix protein Sin3b Transcriptional corepressor Sin3b Histone deacetylase complex subunit Sin3b Sin3b Kiaa0700 protein protein mouse Mus musculus Mouse MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKEVLNDTWVSFPSWSEDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKLRLDDCLGGTSEVIQRRAIHRIYGDKAPEVIESLKRNPATAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIRQLLHRFLPSLFFSQQCPGTSDDSADERDRDRDSAEPERRRPTDEKPPADASPEPPKVLDDVYSLFFANNNWYFFLRLHQTLCARLLKIYRQAQKQLLEHRREQEREQLLCEGRREKAADPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYIGFTMDKLVQNIARQLHHLVSDDVCLKVVELYLNEQQRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQRRGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGSEGASSSSTEGFLLKPVFLQRNLKKFRRWQCEQVRAMRGEAKSSWKRLMGVESACDVDCRFRLGTHKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHRHFEEWHGRWLEDNVTVAAAGLVQDWLMGEEEEDMVPCKTLCETAHVHGLPVTRYRVQYSRRPASP A73F6DFC11EBA256 sap30_mouse Histone deacetylase complex subunit SAP30 30 kDa Sin3-associated polypeptide Sin3 corepressor complex subunit SAP30 Sap30 Sin3-associated polypeptide p30 protein protein mouse Mus musculus Mouse MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVPGAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH A9D4CBDAB97BBD8C rbbp4_mouse Histone-binding protein RBBP4 Rbbp4 Rbap48 Retinoblastoma-binding protein 4 Retinoblastoma-binding protein p48 Chromatin assembly factor 1 subunit C Chromatin assembly factor I p48 subunit Nucleosome-remodeling factor subunit RBAP48 protein protein mouse Mus musculus Mouse MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS DIP protein Q60972 original sequence version: 141 DIP protein Q60972 original sequence version: 117 DIP protein Q60972 original sequence version: 115 B71E2D55A444C360 hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein O09106 original sequence version: 147 DIP protein O09106 original sequence version: 87 DIP protein O09106 original sequence version: 131 DIP protein O09106 original sequence version: 119 DIP protein O09106 original sequence version: 106 DIP protein O09106 original sequence version: 144 DIP protein O09106 original sequence version: 146 DIP protein O09106 original sequence version: 161 DIP protein O09106 original sequence version: 167 DIP protein O09106 original sequence version: 169 DIP protein O09106 original sequence version: 124 DIP protein O09106 original sequence version: 134 DIP protein O09106 original sequence version: 103 DIP protein O09106 original sequence version: 122 7F64D3C17F5E4844 sap30-sin3a-1 6 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells 13 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells physical association physical association The proteins are endogenous. sap30-sin3a-2 1 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association sap30-hdac1-1 1 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey physical association physical association sap30-hdac2-1 1 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sap30-rbap48-1 1 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sap30-sin3a-3 2 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association sap30-sin3b-1 2 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association sap30-ncor1-1 2 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 35s radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association A fragment of NCor1 (AA 1-393) encompassing repression domain was sufficient for binding to GST-Sap30. sap30-sin3a-4 3 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-594578]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 221-221, sequence length 220 [EBI-594578]130-221 n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Demonstrates that interaction occurs with all three fragments (fl, 1-167 and 129-220) of Sap30 and Sin3a. sap30-ncor1-2 3 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Demonstrates that NCor1 interacts with the N-terminus region (AA 1-167) of Sap30 and fails to interact with the C-terminus of Sap30 (AA 129-220). sap30-ncor1-3 4 13 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Demonstrates that the N-terminus region of NCor1 (AA 1-312) was sufficient to interacts with the N-terminus region (AA 1-129) of Sap30. sap30-sin3a-5 7 13 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Demonstrates that the PAH3 domain of Sin3a is sufficient for interaction with Sap30 and deletion of PAH3 resulted in loss of binding. sin3a-ncor1-1 5 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Demonstrates that NCor1 (AA 1-132) binds a region on Sin3a (AA 524-851), which is different to the binding of Sap30 by Sin3a (occuring at the PAH3 region). sap30-sin3a-6 8 13 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-630325]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 221-221, sequence length 220 [EBI-630325]131-221 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey pah binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Demonstrates that the PAH3 domain of Sin3a was sufficient for the isolation of Sap30 in a Y2H assay.