IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional domain mapping of the clathrin-associated adaptor medium chains mu1 and mu2. Functional domain mapping of the clathrin-associated adaptor medium chains mu1 and mu2. J. Biol. Chem. (0021-9258) 1997 Aguilar RC., Ohno H., Roche KW., Bonifacino JS. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Aguilar RC., Ohno H., Roche KW., Bonifacino JS. J. Biol. Chem. (0021-9258) 1997 tgon3_rat Trans-Golgi network integral membrane protein TGN38 Ttgn1 protein protein rat Rattus norvegicus (Rat) Rat MQFLVALLLLSVAVARALPSASKPNNTSSENNPPIQPSTPLPPGVDISQQVKTNRPTDQRLESDKEGQDKTVARTSASVSSGVESATNLNLDDSKKHPETADAKLKETLQQLLPVDPKQEKSGQKFTKDSGSPTGGDSDNTTGGDSNKTTGVDSDKTSGGDSNKPTGSDNDKPTGGDSNKPTSKVPSNTETPKIDKVQLTEKGQKPTLISKTESGEKLAGDSDFSLKPEKGDKSSEPTEDVETKEIEEGDTEPEEGSPLEEENEKVLGPSSSENQEGTLTDSMKDEKDDHYKDNSGNTSAESSHFFAYLVTAAVLVAVLYIAYHNKRKIIAFALEGKRSKVTRRPKASDYQRLNLKL 173B64C51CAD593B ap1m1_human AP-1 complex subunit mu-1 Golgi adaptor HA1/AP1 adaptin mu-1 subunit Mu-adaptin 1 AP-mu chain family member mu1A Mu1A-adaptin Clathrin coat assembly protein AP47 Clathrin coat-associated protein AP47 Adaptor protein complex AP-1 subunit mu-1 Clathrin assembly protein complex 1 mu-1 medium chain 1 AP1M1 CLTNM Adaptor-related protein complex 1 subunit mu-1 protein protein human Homo sapiens Human MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ 64EC5E47EA6F8E98 ap2b1_human AP-2 complex subunit beta AP2B1 CLAPB1 Beta-2-adaptin Beta-adaptin Plasma membrane adaptor HA2/AP2 adaptin beta subunit Clathrin assembly protein complex 2 beta large chain AP105B Adaptor protein complex AP-2 subunit beta ADTB2 Adaptor-related protein complex 2 subunit beta protein protein human Homo sapiens Human MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN DIP protein P63010 original sequence version: 98 DIP protein P63010-1 original sequence version: 109 DIP protein P63010 original sequence version: 129 DIP protein P63010 original sequence version: 134 B472EE5B2AE176DF ap2m1_rat AP-2 complex subunit mu Adaptor protein complex AP-2 subunit mu AP-2 mu chain Ap2m1 Mu2-adaptin Plasma membrane adaptor AP-2 50 kDa protein Clathrin coat assembly protein AP50 Clathrin coat-associated protein AP50 Clathrin assembly protein complex 2 mu medium chain Adaptor-related protein complex 2 subunit mu protein protein rat Rattus norvegicus (Rat) Rat MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC DIP protein P84092 original sequence version: 91 DIP protein P84092 original sequence version: 42 DIP protein P84092 original sequence version: 82 DIP protein P84092 original sequence version: 67 DIP protein P84092 original sequence version: 92 DIP protein P84092 original sequence version: 105 DIP protein P84092 original sequence version: 110 82803219BA279954 ap1m1-ap2b1-1 1 3 unspecified role unspecified role bait bait n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association ap2m1-ap2b1-2 1 5 unspecified role unspecified role bait bait n-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P84092:p.Leu82Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:55:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu82ala' Tue Jun 30 17:23:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu82Ala' P84092:p.Tyr83Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:50:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr83ala' Tue Jun 30 19:33:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr83Ala' P84092:p.Ile96Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Wed May 02 19:02:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile96ala' Tue Jun 30 15:44:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile96Ala' 4 unspecified role unspecified role prey prey physical association physical association ap1m1-tgn41-1 1 2 unspecified role unspecified role bait bait cytoplasmic domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P19814:p.Tyr350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:19:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr350ala' Tue Jun 30 20:07:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr350Ala' 3 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association The hotspot tyrosine 350 is in the transport signal motif SDYQRL (348-353) ap2m1-tgn41-2 1 2 unspecified role unspecified role bait bait P19814:p.Tyr350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:47:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr350ala' Tue Jun 30 20:07:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr350Ala' cytoplasmic domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P84092:p.Met209Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A Wed May 02 17:46:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met209ala' Tue Jun 30 15:51:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met209Ala' P84092:p.Phe265Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:24:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe265ala' Tue Jun 30 19:38:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe265Ala' P84092:p.Asp269Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 14:32:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp269ala' Tue Jun 30 18:15:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp269Ala' P84092:p.Gly270Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G A Wed May 02 18:41:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly270ala' Tue Jun 30 16:48:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly270Ala' physical association physical association The hotspot tyrosine 350 is in the transport signal motif SDYQRL (348-353)