IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PHYL acts to down-regulate TTK88, a transcriptional repressor of neuronal cell fates, by a SINA-dependent mechanism. PHYL acts to down-regulate TTK88, a transcriptional repressor of neuronal cell fates, by a SINA-dependent mechanism. Cell (0092-8674) 1997 Tang AH., Neufeld TP., Kwan E., Rubin GM. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Tang AH., Neufeld TP., Kwan E., Rubin GM. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Cell (0092-8674) 1997 PHYL acts to down-regulate TTK88, a transcriptional repressor of neuronal cell fates, by a SINA-dependent mechanism. PHYL acts to down-regulate TTK88, a transcriptional repressor of neuronal cell fates, by a SINA-dependent mechanism. Cell (0092-8674) 1997 Tang AH., Neufeld TP., Kwan E., Rubin GM. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tang AH., Neufeld TP., Kwan E., Rubin GM. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Cell (0092-8674) 1997 phyl_drome Protein phyllopod phyl CG10108 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTNQQQQANPSAAVAAPAASSEYLKRTCLICGCHTNQTINIYEPRSGPNIVQLIQAKFKFQPLNEDKFLCFSCNNWLINWHSLQAVNSNEAESQSQSPSHMGNSVLQQERTKLRPVAMVRPTVRVQPQSQPQLQPQVPINPTPAPIVYSKRRASRRSASVSRMSRVLRQCCVESLRRSPKKRNQQSVFVCLRPQGQKRSNAICKVECVAPRRKPVERLVKDVAATATPTPVLNTQSTPTYQRFPQPSVDGKVVAMFRRLGTTLSREEPAAYSAESNPACSKLPQIMSPLKEAPRWTRDLDDDEILLEFDTAISEVLPTARYQVTHEENKENQQAQEMELELEEEEEVDGRAELEVVQEAEAPLEPQSHHKQGNSHQNSHQASIQLAGLRLPMGLSISLV DIP protein Q27934 original sequence version: 39 B992F420905407A6 sina_drome E3 ubiquitin-protein ligase sina sina CG9949 Seven in absentia protein RING-type E3 ubiquitin transferase sina protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV B58D7D5E8DA2F958 ubcd1_drome Ubiquitin-conjugating enzyme E2-17 kDa eff UbcD1 CG7425 Ubiquitin-protein ligase Ubiquitin carrier protein Protein effete E2 ubiquitin-conjugating enzyme D1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM 82E0CE24F925E2EE ttka_drome Protein tramtrack, alpha isoform ttk FTZ-F2 CG1856 Tramtrack p88 Repressor protein fushi tarazu protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHPIVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTEVNDDKPSPAAAAAGAGATGSESTATTPQLQRIQPYLVPQRNRSQAGGLLASAANAGNTPTLPVQPSLLSSALMPKRKRGRPRKLSGSSNGTGNDYDDFDRENMMNDSSDLGNGKMCNESYSGNDDGSDDNQPNAGHTDDLNESRDSLPSKRSKNSKDHRVVSHHEDNSTSVTPTKATPELSQRLFGSSSTTISATAPGGSSTGPSETISLLEISDERESAPVHLPTILGLKIRAINTTTPAQQGSPQTPTKSKPKIRQATGSNNSNSLLKQQLRGGAKDPEVPPATRITGAVTPNAALNAEEQSKEMPKKNQDEVNACIGLHSLANAAEQQAAQVASTGNLHHQLLLHMAANNSMLNTTDYYQQQQQESPSSAGQFMDDDLELLSLNDQQDKSDEPDHEMVTLADENAGLPGYQGNEAEATPAQEDSPAAETATAPPPAPRSGKKGAKRPIQRRRVRRKAQSTLDDQAEHLTEMSVRGLDLFRYASVVEGVYRCTECAKENMQKTFKNKYSFQRHAFLYHEGKHRKVFPCPVCSKEFSRPDKMKNHLKMTHENFTPPKDIGAFSPLKYLISAAAAGDMHATIYQQQQDHYHRQLAEQLEQQNASFDSRDSSLILPDVKMEHAEDQDAEQEAELSDGGYDASNPAAAAAAMLSLQQDVIIKDEIQISPSPSPTPPASCAVAEGKSLALASTAQTAT CF3EE14069C79AA2 sina-sina 2 4 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association sina-phyl-5 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association phyl-sina 2 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association phyl-phyl 2 3 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association phyl-ttk-4 2 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association ttk-sina 2 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association sina-eff 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association sina-eff-1 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association phyl-ttk-5 1 3 unspecified role unspecified role prey prey polyoma epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association phyl-ttk-6 1 3 unspecified role unspecified role bait bait polyoma epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association