IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ OX40 is differentially expressed on activated rat and mouse T cells and is the sole receptor for the OX40 ligand. OX40 is differentially expressed on activated rat and mouse T cells and is the sole receptor for the OX40 ligand. Eur. J. Immunol. (0014-2980) 1996 al-Shamkhani A., Birkeland ML., Puklavec M., Brown MH., James W., Barclay AN. The BIAcore analysis system was used in this experiment in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined al-Shamkhani A., Birkeland ML., Puklavec M., Brown MH., James W., Barclay AN. The BIAcore analysis system was used in this experiment Eur. J. Immunol. (0014-2980) 1996 tnfl4_mouse Tumor necrosis factor ligand superfamily member 4 OX40 ligand Tnfsf4 Ox40l Txgp1l protein protein mouse Mus musculus Mouse MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL DIP protein P43488 original sequence version: 42 F4B23A7CC0590459 tnr4_rat Tumor necrosis factor receptor superfamily member 4 OX40L receptor OX40 antigen MRC OX40 Ox40 Txgp1l Tnfrsf4 protein protein rat Rattus norvegicus (Rat) Rat MYVWVQQPTAFLLLGLSLGVTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI C06465136B16E821 ox40-ox40l 1 2 unspecified role unspecified role prey prey region extracellular domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n terminal sCD4-OX40L was immobilzed to a CD4 mAb (covalently bound) to the sensor chip uncategorized protein modification uncategorized protein modification n-term range n-terminal range n-term range n-term range n-terminal range n-term range crisp-kidney Cricetidae sp. kidney kidney [Renal] 3 unspecified role unspecified role bait bait region soluble form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crisp-kidney Cricetidae sp. kidney kidney [Renal] direct interaction direct interaction