MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url&gt;http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of SPIN90 with dynamin I and its participation in synaptic vesicle endocytosis. Interaction of SPIN90 with dynamin I and its participation in synaptic vesicle endocytosis. J. Neurosci. (0270-6474) 2005 Kim Y., Kim S., Lee S., Kim SH., Kim Y., Park ZY., Song WK., Chang S. no SH3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kim Y., Kim S., Lee S., Kim SH., Kim Y., Park ZY., Song WK., Chang S. no SH3 J. Neurosci. (0270-6474) 2005 Interaction of SPIN90 with dynamin I and its participation in synaptic vesicle endocytosis. Interaction of SPIN90 with dynamin I and its participation in synaptic vesicle endocytosis. J. Neurosci. (0270-6474) 2005 Kim Y., Kim S., Lee S., Kim SH., Kim Y., Park ZY., Song WK., Chang S. no SH3 rat-hippocampus_neuron Rattus norvegicus brain-hippocampus_neuron Hippocampal neuron fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kim Y., Kim S., Lee S., Kim SH., Kim Y., Park ZY., Song WK., Chang S. no SH3 J. Neurosci. (0270-6474) 2005 Interaction of SPIN90 with dynamin I and its participation in synaptic vesicle endocytosis. Interaction of SPIN90 with dynamin I and its participation in synaptic vesicle endocytosis. J. Neurosci. (0270-6474) 2005 Kim Y., Kim S., Lee S., Kim SH., Kim Y., Park ZY., Song WK., Chang S. no SH3 rat-hippocampus_neuron Rattus norvegicus brain-hippocampus_neuron Hippocampal neuron anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim Y., Kim S., Lee S., Kim SH., Kim Y., Park ZY., Song WK., Chang S. no SH3 J. Neurosci. (0270-6474) 2005 wasl_rat Neural Wiskott-Aldrich syndrome protein Wasl protein protein rat Rattus norvegicus (Rat) Rat MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYSSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFQDDDEWED DIP protein O08816 original sequence version: 145 DIP protein O08816 original sequence version: 115 480E21F26F7FC77E spn90_mouse NCK-interacting protein with SH3 domain SH3 adapter protein SPIN90 90 kDa SH3 protein interacting with Nck 54 kDa VacA-interacting protein 90 kDa N-WASP-interacting protein Wiskott-Aldrich syndrome protein-binding protein WASP-interacting SH3-domain protein Nckipsd Spin90 Wasbp protein protein mouse Mus musculus Mouse MYRALYAFRSAEPNAMAFAAGETFLVLERSSTHWWLAARARSGETGYVPPAYLHRLQGMEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKETLSRRGTSASSATVMTPSTSDHHLDAAVSRQPNGVCRTGFERQHSLPSSEHLGTDGALYQVPPQPRRAAPTTPPPPVKRRDREALVISGSGGRTAIPSGGSSVSSGSSASSTSMDTLYTGSSPSELGPSCSPTPPPVPRRGAHTTVSQPQPSPSKAPSPEPPTEEVAAETNSTPDDLEAQDALSPETTEEKAAAETVVPRTIGAELMELVRRNTGLSHELCRVAIGVVVGHIQATVPASSPIMEQVLLSLVEGKDLSTALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEDVIRCYLEELLHILTDADPEVCKKMCKRSDFESVLALVAYYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSALVLAMVFSMGEAVPYAHYEHLGTPFAQFLLSIVEDGLPMDTTEQLPDLCMNLLLALNLHLTAPEQNVIMAALSRHTNVKIFSEKLLLLLNRGDDPVRIFRHEPQPPHSVLKFLQDVFSSSATAAIFYHTDMMALIDITVRQIADLSPGDKLRMEYLSLMHAVVRSTPYLQHRHRLSDLQATLRRILTEEEASPQCQMDRMIVQEMYKEFPDLGEVPS 2111AB09799F4718 syph_rat Synaptophysin Major synaptic vesicle protein p38 Syp protein protein rat Rattus norvegicus (Rat) Rat MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM A245E4F70BF0EAF0 dyn1_rat Dynamin-1 Dnm1 Dnm D100 Dynamin, brain B-dynamin protein protein rat Rattus norvegicus (Rat) Rat MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPSRSGQASPSRPESPRPPFDL DIP protein P21575 original sequence version: 142 DIP protein P21575-1 original sequence version: 114 02EC9B533CC2EC83 vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63045 original sequence version: 95 DIP protein P63045 original sequence version: 90 DIP protein P63045 original sequence version: 64 DIP protein P63045 original sequence version: 62 DIP protein P63045 original sequence version: 85 DIP protein P63045 original sequence version: 104 DIP protein P63045 original sequence version: 77 DIP protein P63045 original sequence version: 75 DIP protein P63045 original sequence version: 106 4A0D0D56B5409D0A sh3g2_rat Endophilin-A1 Sh3gl2 Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A SH3p4 Sh3d2a Sh3p4 protein protein rat Rattus norvegicus (Rat) Rat MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDGTQPNGGLSHTGTPKPAGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH 382B6F651885B679 dnm1-nckipsd 2 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F3E UP_ID for rat SPIN90 is not available so it's been used the murine one homomint mint nckipsd-syp 2 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F2 UP_ID for rat SPIN90 is not available so it's been used the murine one<br> homomint mint nckipsd-vamp2 2 8 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F2 UP_ID for rat SPIN90 is not available so it's been used the murine one<br> homomint mint nckipsd-wasl-2 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1487503: original sequence: 1-56 : MYRALYAFRSAEPNAMAFAAGETFLVLERSSTHWWLAARARSGETGYVPPAYLHR Stoichiometry: 1.0 4 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F3A UP_ID for rat SPIN90 is not available so it's been used the murine one homomint domino mint nckipsd-dnm1 1 7 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1487435: original sequence: 1-56 : MYRALYAFRSAEPNAMAFAAGETFLVLERSSTHWWLAARARSGETGYVPPAYLHR Stoichiometry: 1.0 physical association physical association F3A UP_ID for rat SPIN90 is not available so it's been used the murine one<br> homomint domino mint sh3gl2-dnm1-4 1 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1487454: original sequence: 189-243 : KFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEE Stoichiometry: 1.0 7 fingerprinting peptide massfingerprinting fingerprinting predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1A UP_ID for rat SPIN90 is not available so it's been used the murine one homomint domino mint dnm1-nckipsd-1 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1487400: original sequence: 1-56 : MYRALYAFRSAEPNAMAFAAGETFLVLERSSTHWWLAARARSGETGYVPPAYLHR Stoichiometry: 1.0 direct interaction direct interaction F3B UP_ID for rat SPIN90 is not available so it's been used the murine one homomint domino mint nckipsd-dnm1-1 3 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F3C UP_ID for rat SPIN90 is not available so it's been used the murine one homomint mint dnm1-nckipsd-2 3 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F3C UP_ID for rat SPIN90 is not available so it's been used the murine one homomint mint