MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. J. Biol. Chem. (0021-9258) 2005 Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no J. Biol. Chem. (0021-9258) 2005 Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. J. Biol. Chem. (0021-9258) 2005 Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no J. Biol. Chem. (0021-9258) 2005 Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. J. Biol. Chem. (0021-9258) 2005 Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no J. Biol. Chem. (0021-9258) 2005 Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. J. Biol. Chem. (0021-9258) 2005 Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no J. Biol. Chem. (0021-9258) 2005 Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. J. Biol. Chem. (0021-9258) 2005 Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no J. Biol. Chem. (0021-9258) 2005 Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. J. Biol. Chem. (0021-9258) 2005 Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no J. Biol. Chem. (0021-9258) 2005 Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. J. Biol. Chem. (0021-9258) 2005 Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no J. Biol. Chem. (0021-9258) 2005 Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL. J. Biol. Chem. (0021-9258) 2005 Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baum W., Kirkin V., Fernández SB., Pick R., Lettau M., Janssen O., Zörnig M. no J. Biol. Chem. (0021-9258) 2005 ptn12_mouse Tyrosine-protein phosphatase non-receptor type 12 Protein-tyrosine phosphatase P19 Ptpn12 MPTP-PEST protein protein mouse Mus musculus Mouse MEQVEILRRFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVKKNRYKDILPFDHSRVKLTLKTPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREFEMGRKKCERYWPLYGEDPITFAPFKISCENEQARTDYFIRTLLLEFQNESRRLYQFHYVNWPDHDVPSSFDSILDMISLMRKYQEHEDVPICIHCSAGCGRTGAICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQLYEIHGAQKIADGNEITTGTMVSSIDSEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPHPVPPILTPSPPSAFPTVTTVWQDSDRYHPKPVLHMASPEQHPADLNRSYDKSADPMGKSESAIEHIDKKLERNLSFEIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASSSVVDRTSKPQELSAGALKVDDVSQNSCADCSAAHSHRAAESSEESQSNSHTPPRPDCLPLDKKGHVTWSLHGPENATPVPDSPDGKSPDNHSQTLKTVSSTPNSTAEEEAHDLTEHHNSSPLLKAPLSFTNPLHSDDSDSDGGSSDGAVTRNKTSISTASATVSPASSAESACTRRVLPMSIARQEVAGTPHSGAEKDADVSEESPPPLPERTPESFVLADMPVRPEWHELPNQEWSEQRESEGLTTSGNEKHDAGGIHTEASADSPPAFSDKKDQITKSPAEVTDIGFGNRCGKPKGPREPPSEWT ED1A7A577CE4352C q53zz1_human ADAM10-processed FasL form TNFSF6 FASLG TNLG1A CD95 ligand Fas antigen ligand FasL intracellular domain Receptor-binding FasL ectodomain SPPL2A-processed FasL form Soluble Fas ligand Tumor necrosis factor ligand superfamily member 6 Tumor necrosis factor ligand superfamily member 6, membrane form Tumor necrosis factor ligand superfamily member 6, soluble form hCG_37643 protein protein human Homo sapiens Human MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL mint A8A6EB358246E9BB tnfl6_mouse Tumor necrosis factor ligand superfamily member 6 Faslg Apt1lg1 Fasl gld Tnfsf6 Fas antigen ligand Cd95l CD95 ligand protein protein mouse Mus musculus Mouse MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSLKVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL mint Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects A deficiency in this protein is the cause of generalized lymphoproliferation disease phenotype (gld). Gld mice present lymphadenopathy and autoantibody production. The phenotype is recessively inherited 37972E2728E0A1CA ppip1_mouse Proline-serine-threonine phosphatase-interacting protein 1 Pstpip1 protein protein mouse Mus musculus Mouse MMAQLQFRDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDVEELLRQRAQAEERYGKELVQIARKAGGQTEMNSLRTSFDSLKQQTENVGSAHIQLALALREELRSLEEFRERQKEQRKKYEAIMDRVQKSKLSLYKKTMESKKAYDQKCRDADDAEQAFERVSANGHQKQVEKSQNKAKQCKESATEAERVYRQNIEQLERARTEWEQEHRTTCEAFQLQEFDRLTILRNALWVHCNQLSMQCVKDDELYEEVRLTLEGCDVEGDINGFIQSKSTGREPPAPVPYQNYYDREVTPLIGSPSIQPSCGVIKRFSGLLHGSPKTTPSAPAASTETLTPTPERNELVYASIEVQATQGNLNSSAQDYRALYDYTAQNSDELDISAGDILAVILEGEDGWWTVERNGQRGFVPGSYLEKL mint homomint Involved in regulation of the actin cytoskeleton. May regulate the WAS actin-bundling activity. Bridges the interaction between ABL1 and PTPN18 leading to the ABL1 dephosphorylation. May play a role as a scaffold protein between PTPN12 and WAS, and allows PTPN12 to dephosphorylate WAS. Has the potential to physically couple CD2 and CD2AP to WAS. Acts downstream of CD2 and CD2AP to recruit WAS to the T-cell:APC contact site so as to promote the actin polymeriszation required for synapse induction during T-cell activation. Down-regulates CD2-stimulated adhesion through coupling PTPN12 to CD2 16C0329284D2739C ppip1_human Proline-serine-threonine phosphatase-interacting protein 1 CD2-binding protein 1 H-PIP PSTPIP1 CD2BP1 protein protein human Homo sapiens Human MMPQLQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSLKQQMENVGSSHIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRVQKSKLSLYKKAMESKKTYEQKCRDADDAEQAFERISANGHQKQVEKSQNKARQCKDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSMQCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPGIQPSCGMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKL 97818150B3D5D600 pstpip1-ptpn12-3 3 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4A homomint mint pstpip1-faslg 3 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1486476: original sequence: 5-98 : LQFKDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSLKQQMENVGSSHIQLALT Stoichiometry: 1.0 physical association physical association F4A homomint mint faslg-pstpip1-2 8 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F3A homomint mint faslg-pstpip1-3 5 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2A homomint mint faslg-pstpip1-4 5 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 12 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F2A homomint mint faslg-pstpip1-5 5 12 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1486657: original sequence: 40-80 : PGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHST flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2D homomint mint pstpip1-faslg-1 5 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2B homomint mint faslg-pstpip1-6 1 12 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F2C homomint mint faslg-pstpip1-7 1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 13 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F2C homomint mint pstpip1-faslg-2 2 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1486736: original sequence: 81-270 : LCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNF Stoichiometry: 1.0 direct interaction direct interaction F1A homomint mint faslg-pstpip1-8 2 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1486580: original sequence: 361-415 : QDYRALYDYTAQNSDELDISAGDILAVILEGEDGWWTVERNGQRGFVPGSYLEK Stoichiometry: 1.0 direct interaction direct interaction F1B homomint mint ptpn12-pstpip1 6 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F4B homomint mint ptpn12-faslg 6 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F4B Interaction occurs only whether mPSTPIP is cotransfected homomint mint faslg-pstpip1-9 4 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1486717: original sequence: 40-80 : PGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHST Stoichiometry: 1.0 13 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F7 homomint Same colocalization occurs in Hek-293T cells mint faslg-pstpip1-10 7 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1486749: original sequence: 1-80 : MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPLKKKDHNTNL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain range MINT-1486757: original sequence: 130-415 : KLSLYKKTMESKKAYDQKCRDADDAEQAFERVSANGHQKQVEKSQNKAKQCKESATEAERVYRQNIEQLERARTEWEQEHRTTCEAFQLQEFDRLTILRNALWVHCNQLSMQCVKDDELYEEVRLTLEGCDVEGDINGFIQSKSTGREPPAPVPYQNYYDREVTPLIGSPSIQPSCGVIKRFSGLLHGSPKTTPSAPAASTETLTPTPERNELVYASIEVQATQGNLNSSAQDYRALYDYTAQNSDELDISAGDILAVILEGEDGWWTVERNGQRGFVPGSYLEK Stoichiometry: 1.0 physical association physical association NFA homomint mint