IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Physical and functional mapping of the replication protein a interaction domain of the werner and bloom syndrome helicases. Physical and functional mapping of the replication protein a interaction domain of the werner and bloom syndrome helicases. J. Biol. Chem. (0021-9258) 2005 Doherty KM., Sommers JA., Gray MD., Lee JW., von Kobbe C., Thoma NH., Kureekattil RP., Kenny MK., Brosh RM. Table 1, Fig 2 broshR@grc.nia.nih.gov in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Doherty KM., Sommers JA., Gray MD., Lee JW., von Kobbe C., Thoma NH., Kureekattil RP., Kenny MK., Brosh RM. The dissociation constant Kd was determined by changing the amount of the probe. The Kd was determined by Hill plot and scatchard binding theory. Table 1, Fig 2 broshR@grc.nia.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2005 Physical and functional mapping of the replication protein a interaction domain of the werner and bloom syndrome helicases. Physical and functional mapping of the replication protein a interaction domain of the werner and bloom syndrome helicases. J. Biol. Chem. (0021-9258) 2005 Doherty KM., Sommers JA., Gray MD., Lee JW., von Kobbe C., Thoma NH., Kureekattil RP., Kenny MK., Brosh RM. Table 1, Fig 2 broshR@grc.nia.nih.gov in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Doherty KM., Sommers JA., Gray MD., Lee JW., von Kobbe C., Thoma NH., Kureekattil RP., Kenny MK., Brosh RM. Table 1, Fig 2 broshR@grc.nia.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2005 Physical and functional mapping of the replication protein a interaction domain of the werner and bloom syndrome helicases. Physical and functional mapping of the replication protein a interaction domain of the werner and bloom syndrome helicases. J. Biol. Chem. (0021-9258) 2005 Doherty KM., Sommers JA., Gray MD., Lee JW., von Kobbe C., Thoma NH., Kureekattil RP., Kenny MK., Brosh RM. Table 1, Fig 2 broshR@grc.nia.nih.gov yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Doherty KM., Sommers JA., Gray MD., Lee JW., von Kobbe C., Thoma NH., Kureekattil RP., Kenny MK., Brosh RM. Table 1, Fig 2 broshR@grc.nia.nih.gov Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2005 rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE DIP protein P15927 original sequence version: 119 DIP protein P15927-1 original sequence version: 125 DIP protein P15927 original sequence version: 114 61A563EA7B34A9B1 blm_human Bloom syndrome protein RecQ protein-like 3 DNA helicase, RecQ-like type 2 BLM RECQ2 RECQL3 protein protein human Homo sapiens Human MAAVPQNNLQEQLERHSARTLNNKLSLSKPKFSGFTFKKKTSSDNNVSVTNVSVAKTPVLRNKDVNVTEDFSFSEPLPNTTNQQRVKDFFKNAPAGQETQRGGSKSLLPDFLQTPKEVVCTTQNTPTVKKSRDTALKKLEFSSSPDSLSTINDWDDMDDFDTSETSKSFVTPPQSHFVRVSTAQKSKKGKRNFFKAQLYTTNTVKTDLPPPSSESEQIDLTEEQKDDSEWLSSDVICIDDGPIAEVHINEDAQESDSLKTHLEDERDNSEKKKNLEEAELHSTEKVPCIEFDDDDYDTDFVPPSPEEIISASSSSSKCLSTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSVSPGDCLLTTTLGKTGFSATRKNLFERPLFNTHLQKSFVSSNWAETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASINDLERETQPSYDIDNFDIDDFDDDDDWEDIMHNLAASKSSTAAYQPIKEGRPIKSVSERLSSAKTDCLPVSSTAQNINFSESIQNYTDKSAQNLASRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTVVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTLQRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKSVEGYYQESGRAGRDGEISHCLLFYTYHDVTRLKRLIMMEKDGNHHTRETHFNNLYSMVHYCENITECRRIQLLAYFGENGFNPDFCKKHPDVSCDNCCKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDSSPGISLSSSRGPGRSAAEELDEEIPVSSHYFASKTRNERKRKKMPASQRSKRRKTASSGSKAKGGSATCRKISSKTKSSSIIGSSSASHTSQATSGANSKLGIMAPPKPINRPFLKPSYAFS DIP protein P54132 original sequence version: 155 DIP protein P54132 original sequence version: 109 DIP protein P54132 original sequence version: 146 DIP protein P54132 original sequence version: 111 423DF5F381194E11 rfa3_human Replication protein A 14 kDa subunit Replication factor A protein 3 RPA3 REPA3 RPA14 protein protein human Homo sapiens Human MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD DIP protein P35244 original sequence version: 96 3FD99851959FB498 rfa1_human Replication protein A 70 kDa DNA-binding subunit Replication factor A protein 1 Single-stranded DNA-binding protein RPA1 REPA1 RPA70 protein protein human Homo sapiens Human MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM DIP protein P27694 original sequence version: 116 DIP protein P27694 original sequence version: 146 DIP protein P27694 original sequence version: 111 DIP protein P27694 original sequence version: 125 FE038F40F5886CD1 wrn_human Werner syndrome ATP-dependent helicase WRN RECQ3 RECQL2 Exonuclease WRN RecQ protein-like 2 DNA helicase, RecQ-like type 3 protein protein human Homo sapiens Human MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRRVSILLKDISENLYSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGEDVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYKSTEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLENLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQANEELCPKKLLLPSSKTVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISSGSNISKKSIMVQSPEKAYSSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS DIP protein Q14191 original sequence version: 125 DIP protein Q14191 original sequence version: 175 63F10D19E90AA461 wrn-rpa70-1 3 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey acidic region sufficient to bind sufficient binding region sufficient to bind range range range range 1repeat deletion required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tandem acidic repeat required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association rpa1-rpa2-2 3 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait physical association physical association rpa2-rpa3-1 3 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association wrn-rpa1-2 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tandem acidic repeat required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain acidic region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Purified WRN proteins were mixed with purified hRPA composed of RPA70, RPA32 and RPA14. The western-blotting was done using only an antibody against the 70kDa subunit. hRPA is composed of RPA70, RPA32 and RPA14 and was purified from Hela cells by multi step columns purification. One of the key step is a single-strand DNA cellulose column.(see PMID: 2159011) The DnaseI treatment does not impairs the interaction showing it is not mediated by DNA binding. to be added when rules updated:rfa1 expressed in human hela wrn-rpa1-3 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Purified WRN proteins were mixed with purified hRPA composed of RPA70, RPA32 and RPA14. The western-blotting was done using only an antibody against the 70kDa subunit. hRPA is composed of RPA70, RPA32 and RPA14 and was purified from Hela cells by multi step columns purification. One of the key step is a single-strand DNA cellulose column.(see PMID: 2159011) The interaction is resistant to the presence of ethidium bromide showing DNA is not responsible for the interaction. to be added when rules updated:rfa1 expressed in human hela wrn-rpa1-4 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Purified WRN proteins were mixed with purified hRPA composed of RPA70, RPA32 and RPA14. The western-blotting was done using only an antibody against the 70kDa subunit. hRPA is composed of RPA70, RPA32 and RPA14 and was purified from Hela cells by multi step columns purification. One of the key step is a single-strand DNA cellulose column.(see PMID: 2159011) The interaction is resistant to the presence of ethidium bromide showing DNA is not responsible for the interaction. to be added when rules updated:rfa1 expressed in human hela wrn-rpa1-5 1 7 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 8 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Wells were coated with purified WRN proteins. Purified hRPA trimer composed of RPA70, RPA32 and RPA14 was added. ELISA was done using only an antibody against the 70kDa subunit. hRPA is composed of RPA70, RPA32 and RPA14 and was purified from Hela cells by multi step columns purification. One of the key step is a single-strand DNA cellulose column.(see PMID: 2159011) wrn-rpa1-6 1 7 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 8 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Wells were coated with purified WRN proteins. Purified hRPA trimer composed of RPA70, RPA32 and RPA14 was added. ELISA was done using only an antibody against the 70kDa subunit. hRPA is composed of RPA70, RPA32 and RPA14 and was purified from Hela cells by multi step columns purification. One of the key step is a single-strand DNA cellulose column.(see PMID: 2159011) blm-rpa1-1 1 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association Wells were coated with purified BLM proteins. Purified hRPA trimer composed of RPA70, RPA32 and RPA14 was added. ELISA was done using only an antibody against the 70kDa subunit. hRPA is composed of RPA70, RPA32 and RPA14 and was purified from Hela cells by multi step columns purification. One of the key step is a single-strand DNA cellulose column.(see PMID: 2159011) blm-rpa1-2 1 7 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 5 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Wells were coated with purified BLM proteins. Purified hRPA trimer composed of RPA70, RPA32 and RPA14 was added. ELISA was done using only an antibody against the 70kDa subunit. hRPA is composed of RPA70, RPA32 and RPA14 and was purified from Hela cells by multi step columns purification. One of the key step is a single-strand DNA cellulose column.(see PMID: 2159011)