MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Unrip is a component of SMN complexes active in snRNP assembly. Unrip is a component of SMN complexes active in snRNP assembly. FEBS Lett. (0014-5793) 2005 imex curation Carissimi C., Baccon J., Straccia M., Chiarella P., Maiolica A., Sawyer A., Rappsilber J., Pellizzoni L. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Carissimi C., Baccon J., Straccia M., Chiarella P., Maiolica A., Sawyer A., Rappsilber J., Pellizzoni L. FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation ruxe_human Small nuclear ribonucleoprotein E SNRPE Sm protein E protein protein human Homo sapiens Human MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN DIP protein P62304 original sequence version: 64 DIP protein P62304 original sequence version: 87 DIP protein P62304 original sequence version: 73 DIP protein P62304 original sequence version: 123 7D8881CE1F4FA2FD gemi6_human Gem-associated protein 6 SIP2 GEMIN6 protein protein human Homo sapiens Human MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ DIP protein Q8WXD5 original sequence version: 79 908EEFDA73A0C07F strap_human Serine-threonine kinase receptor-associated protein UNR-interacting protein WD-40 repeat protein PT-WD MAP activator with WD repeats STRAP MAWD UNRIP protein protein human Homo sapiens Human MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA CFCB34D3946290E2 smd2_human Small nuclear ribonucleoprotein Sm D2 SNRPD2 snRNP core protein D2 SNRPD1 protein protein human Homo sapiens Human MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK DIP protein P62316 original sequence version: 74 DIP protein P62316 original sequence version: 97 DIP protein P62316 original sequence version: 83 DIP protein P62316 original sequence version: 134 D986059D82B7E045 gemi7_human Gem-associated protein 7 SIP3 GEMIN7 protein protein human Homo sapiens Human MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP DIP protein Q9H840 original sequence version: 73 6E118922AFDCF567 rsmb_human Small nuclear ribonucleoprotein-associated proteins B and B' Sm protein B/B' SNRPB COD SNRPB1 protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP DIP protein P14678 original sequence version: 150 DIP protein P14678 original sequence version: 131 DIP protein P14678 original sequence version: 186 F2E1D5E11A601170 smd3_human Small nuclear ribonucleoprotein Sm D3 SNRPD3 snRNP core protein D3 protein protein human Homo sapiens Human MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR DIP protein P62318 original sequence version: 72 DIP protein P62318 original sequence version: 95 DIP protein P62318 original sequence version: 81 DIP protein P62318 original sequence version: 102 DIP protein P62318 original sequence version: 131 59A6E78E860AA3E0 gemin6-strap 1 3 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F4A FEBS-Letters homomint mint gemin7-strap 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F4A FEBS-Letters homomint mint gemin7-strap-1 1 6 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F4B FEBS-Letters homomint mint gemin6-strap-1 1 3 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F4B FEBS-Letters homomint mint strap-snrpb 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F4C FEBS-Letters homomint mint strap-snrpd2 1 5 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction F4C FEBS-Letters homomint mint strap-snrpd3 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F4C FEBS-Letters homomint mint strap-snrpe 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 2 full dna sequence full identification by DNA sequencing full dna sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F4C FEBS-Letters homomint mint