IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction with the SH3 domain protein Bem1 regulates signaling by the Saccharomyces cerevisiae p21-activated kinase Ste20. Interaction with the SH3 domain protein Bem1 regulates signaling by the Saccharomyces cerevisiae p21-activated kinase Ste20. Mol. Cell. Biol. (0270-7306) 2005 Winters MJ., Pryciak PM. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Winters MJ., Pryciak PM. Mol. Cell. Biol. (0270-7306) 2005 Interaction with the SH3 domain protein Bem1 regulates signaling by the Saccharomyces cerevisiae p21-activated kinase Ste20. Interaction with the SH3 domain protein Bem1 regulates signaling by the Saccharomyces cerevisiae p21-activated kinase Ste20. Mol. Cell. Biol. (0270-7306) 2005 Winters MJ., Pryciak PM. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Winters MJ., Pryciak PM. Mol. Cell. Biol. (0270-7306) 2005 ste20_yeast Serine/threonine-protein kinase STE20 STE20 YHL007C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNDPSAVSELPDKDSLDNGISNDNERAMGGNGDGGDGLRLPRTTGTLNVNALQKGTNAAHEAGGYKSMDPAKNAETTNDDDNNVVSLDDPIQFTRVSSSSVISGMSSSMSPHSNIDETKSLEAVTPNINTSNITPDHSADNTFSTINASESDHQFNDTLLSKLSLTDSTETIENNATVKHQQPVASSTVNSNKSSTDIRRATPVSTPVISKPSMTTTPRQINSASHSLSNPKHKQHKPKVKPSKPEAKSKPVSVKKSFPSKNPLKNSSPPKKQTEKSYYSSSSKKRKSGSNSGTLRMKDVFTSFVQNIKRNSQDDKRASSSSNNSSSSSITTALRISTPYNAKHIHHVGVDSKTGEYTGLPEEWEKLLTSSGISKREQQQNMQAVMDIVKFYQDVTETNGEDKMFKTFNTTTGLPGSPQVSTPPANSFNKFPPSTSDSHNYGSRTGTPMSNHVMSPTLNTDSSSANGKFIPSRPAPKPPSSASASAPIIKSPVMNSAANVSPLKQTHAPTTPNRTSPNRSSISRNATLKKEEQPLPPIPPTKSKTSPIISTAHTPQQVAQSPKAPAQETVTTPTSKPAQARSLSKELNEKKREERERRKKQLYAKLNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVKLARLKKVAENMDADEDNDDDNDNEHINKTNNCDDNNDSKETVNLDVTEDDKQK 69C1C12F5B87733C 69C1C12F5B87733C nbp2_yeast NAP1-binding protein 2 NBP2 YDR162C protein protein yeast Saccharomyces cerevisiae Baker's yeast MATMETTTQKDTNILKSGLKKTIGVLNEAVLQNGREVEAVQAGNSDTMEDTETTTIGYISIKDYAYADSNPLHYGYFDGDNEEDEMVSDSSNGEDTYNKRQSITLPDDYIVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPEDGENEVENKARPFYLTHLITQSVSPKNNIDNTNEDEYDDNDEWEDIDDVAEVEADMKTKLDISD A7458854D5000EA6 A7458854D5000EA6 cdc42_yeast Cell division control protein 42 CDC42 SRO2 YLR229C L8083.13 Suppressor of RHO3 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL 30BD644BA9836B2C 30BD644BA9836B2C bem1_yeast Bud emergence protein 1 Suppressor of RHO3 protein 1 BEM1 SRO1 YBR200W YBR1412 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKNFKLSKRDSNGSKGRITSADISTPSHDNGSVIKHIKTVPVRYLSSSSTPVKSQRDSSPKNRHNSKDITSPEKVIKAKYSYQAQTSKELSFMEGEFFYVSGDEKDWYKASNPSTGKEGVVPKTYFEVFDRTKPSSVNGSNSSSRKVTNDSLNMGSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVEQQQQQSITKPQNKSAKLVDGELLVKASVESFGLEDEKYWFLVCCELSNGKTRQLKRYYQDFYDLQVQLLDAFPAEAGKLRDAGGQWSKRIMPYIPGPVPYVTNSITKKRKEDLNIYVADLVNLPDYISRSEMVHSLFVVLNNGFDREFERDENQNNIKTLQENDTATFATASQTSNFASTNQDNTLTGEDLKLNKKLSDLSLSGSKQAPAQSTSGLKTTKIKFYYKDDIFALMLKGDTTYKELRSKIAPRIDTDNFKLQTKLFDGSGEEIKTDSQVSNIIQAKLKISVHDI FB6C525AE9A19181 FB6C525AE9A19181 ste20-bem1-1 2 3 unspecified role unspecified role bait bait proline rich motif binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ste20-bem1-2 2 3 unspecified role unspecified role bait bait Q03497:p.[Pro475Gly;Pro477Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P G certain certain sequence position certain certain certain sequence position certain P A Fri Jul 22 11:04:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro477ala,pro475gly' Wed May 02 18:20:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro475gly,pro477ala' Tue Jun 30 17:04:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro475Gly;Pro477Ala]' region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q03497:p.Phe470Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F G Wed May 02 18:07:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe470gly' Tue Jun 30 20:00:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe470Gly' Q03497:p.Ile471Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I G Wed May 02 17:10:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile471gly' Tue Jun 30 18:10:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile471Gly' Q03497:p.Pro472Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 17:52:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro472ala' Tue Jun 30 17:29:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro472Ala' Q03497:p.Ser473Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:23:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser473ala' Tue Jun 30 18:20:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser473Ala' Q03497:p.Arg474Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R G Wed May 02 15:43:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg474gly' Tue Jun 30 16:28:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg474Gly' Q03497:p.Pro475Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P G Wed May 02 18:22:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro475gly' Tue Jun 30 17:37:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro475Gly' Q03497:p.Ala476Gly mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A G Wed May 02 18:28:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala476gly' Tue Jun 30 20:01:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala476Gly' Q03497:p.Pro477Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:24:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro477ala' Tue Jun 30 17:55:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro477Ala' Q03497:p.Pro479Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:35:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro479ala' Tue Jun 30 18:17:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro479Ala' Q03497:p.Pro480Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:07:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro480ala' Tue Jun 30 20:06:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro480Ala' 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Analysis of the mutants interaction Bem1 with by B-gal measurement compared to wild type ste20 (=100%): K478A=43%, S473A=16%, P479A=5%, all others mutants <2%. ste20-cdc42-1 2 5 unspecified role unspecified role prey prey P19073:p.[Gly12Val;Cys188Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain G V certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:51:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val,cys188ser' Tue Jun 30 16:17:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly12Val;Cys188Ser]' 3 unspecified role unspecified role bait bait crib binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Gly12Val Cdc42 is constitutively active GTP-bound so it can binds to effectors like ste20. Cys188Ser Cdc42 is not lipid-modified so it can be used in the Y2H system. ste20-bem1-3 1 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q03497:p.[Pro475Gly;Pro477Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P G certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:06:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro475gly,pro477ala' Tue Jun 30 16:43:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro475Gly;Pro477Ala]' c-terminus required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association ste20-bem1-4 2 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P29366:p.Trp192Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:44:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp192ala' Tue Jun 30 17:23:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp192Ala' 3 unspecified role unspecified role bait bait proline rich motif required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 43 46 physical association physical association W192A mutation in the second SH3 of Bem1 is the mutation of the SH3 highly conserved tryptophan involved in binding proline-rich ligand. The equivalent mutation in the first SH3 had no effect on interaction. ste20-nbp2-1 2 3 unspecified role unspecified role bait bait proline rich motif binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association ste20-nbp2-2 1 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q03497:p.[Pro475Gly;Pro477Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P G certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:41:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro475gly,pro477ala' Tue Jun 30 17:08:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro475Gly;Pro477Ala]' c-terminus required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association