IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Alpha-actinin-2, a cytoskeletal protein, binds to angiogenin. Alpha-actinin-2, a cytoskeletal protein, binds to angiogenin. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Hu H., Gao X., Sun Y., Zhou J., Yang M., Xu Z. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hu H., Gao X., Sun Y., Zhou J., Yang M., Xu Z. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Alpha-actinin-2, a cytoskeletal protein, binds to angiogenin. Alpha-actinin-2, a cytoskeletal protein, binds to angiogenin. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Hu H., Gao X., Sun Y., Zhou J., Yang M., Xu Z. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hu H., Gao X., Sun Y., Zhou J., Yang M., Xu Z. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Alpha-actinin-2, a cytoskeletal protein, binds to angiogenin. Alpha-actinin-2, a cytoskeletal protein, binds to angiogenin. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Hu H., Gao X., Sun Y., Zhou J., Yang M., Xu Z. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Hu H., Gao X., Sun Y., Zhou J., Yang M., Xu Z. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Alpha-actinin-2, a cytoskeletal protein, binds to angiogenin. Alpha-actinin-2, a cytoskeletal protein, binds to angiogenin. Biochem. Biophys. Res. Commun. (0006-291X) 2005 Hu H., Gao X., Sun Y., Zhou J., Yang M., Xu Z. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Hu H., Gao X., Sun Y., Zhou J., Yang M., Xu Z. Biochem. Biophys. Res. Commun. (0006-291X) 2005 angi_human Angiogenin Ribonuclease 5 ANG RNASE5 protein protein human Homo sapiens Human MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP 9C462DA3C8D39ACC actn2_human Alpha-actinin-2 ACTN2 Alpha-actinin skeletal muscle isoform 2 F-actin cross-linking protein protein protein human Homo sapiens Human MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL DIP protein P35609 original sequence version: 118 DIP protein P35609 original sequence version: 117 7F612C1C3B3E2299 ang-actn2-1 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ang-actn2-2 1 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association ang-actn2-3 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 35s radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association ang-actn2-4 3 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept cfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role fluorescence donor fluorescence donor eyfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction