MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it WRKY group IId transcription factors interact with calmodulin. WRKY group IId transcription factors interact with calmodulin. FEBS Lett. (0014-5793) 2005 imex curation Park CY., Lee JH., Yoo JH., Moon BC., Choi MS., Kang YH., Lee SM., Kim HS., Kang KY., Chung WS., Lim CO., Cho MJ. It was not possible to unambiguously identify the protein called PDE in the paper and therefore interactions involving this protein were not curated. no colim@gsnu.ac.kr, choslab@gsnu.ac.kr 23-Dec-2009: Contacted by JYOTI. Arabidopsis Lamda ZAPII cDNA expression library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Park CY., Lee JH., Yoo JH., Moon BC., Choi MS., Kang YH., Lee SM., Kim HS., Kang KY., Chung WS., Lim CO., Cho MJ. It was not possible to unambiguously identify the protein called PDE in the paper and therefore interactions involving this protein were not curated. no colim@gsnu.ac.kr, choslab@gsnu.ac.kr Accepted 2009-AUG-22 by ORCHARD. 23-Dec-2009: Contacted by JYOTI. Arabidopsis Lamda ZAPII cDNA expression library FEBS Lett. (0014-5793) 2005 orchard Only protein-protein interactions imex curation WRKY group IId transcription factors interact with calmodulin. WRKY group IId transcription factors interact with calmodulin. FEBS Lett. (0014-5793) 2005 imex curation Park CY., Lee JH., Yoo JH., Moon BC., Choi MS., Kang YH., Lee SM., Kim HS., Kang KY., Chung WS., Lim CO., Cho MJ. It was not possible to unambiguously identify the protein called PDE in the paper and therefore interactions involving this protein were not curated. no colim@gsnu.ac.kr, choslab@gsnu.ac.kr 23-Dec-2009: Contacted by JYOTI. Arabidopsis Lamda ZAPII cDNA expression library orchard Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay tag visualisation tag visualisation Park CY., Lee JH., Yoo JH., Moon BC., Choi MS., Kang YH., Lee SM., Kim HS., Kang KY., Chung WS., Lim CO., Cho MJ. It was not possible to unambiguously identify the protein called PDE in the paper and therefore interactions involving this protein were not curated. no Tag visualisation performed using a peroxidase assay. colim@gsnu.ac.kr, choslab@gsnu.ac.kr Accepted 2009-AUG-22 by ORCHARD. 23-Dec-2009: Contacted by JYOTI. Arabidopsis Lamda ZAPII cDNA expression library FEBS Lett. (0014-5793) 2005 orchard Only protein-protein interactions imex curation WRKY group IId transcription factors interact with calmodulin. WRKY group IId transcription factors interact with calmodulin. FEBS Lett. (0014-5793) 2005 imex curation Park CY., Lee JH., Yoo JH., Moon BC., Choi MS., Kang YH., Lee SM., Kim HS., Kang KY., Chung WS., Lim CO., Cho MJ. It was not possible to unambiguously identify the protein called PDE in the paper and therefore interactions involving this protein were not curated. no colim@gsnu.ac.kr, choslab@gsnu.ac.kr 23-Dec-2009: Contacted by JYOTI. Arabidopsis Lamda ZAPII cDNA expression library orchard Only protein-protein interactions in vitro In vitro lambda phage lambda phage display lambda phage nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Park CY., Lee JH., Yoo JH., Moon BC., Choi MS., Kang YH., Lee SM., Kim HS., Kang KY., Chung WS., Lim CO., Cho MJ. It was not possible to unambiguously identify the protein called PDE in the paper and therefore interactions involving this protein were not curated. no colim@gsnu.ac.kr, choslab@gsnu.ac.kr Accepted 2009-AUG-22 by ORCHARD. 23-Dec-2009: Contacted by JYOTI. Arabidopsis Lamda ZAPII cDNA expression library FEBS Lett. (0014-5793) 2005 orchard Only protein-protein interactions imex curation wrk15_arath Probable WRKY transcription factor 15 WRKY15 WRKY DNA-binding protein 15 T20D16.5 At2g23320 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVELMTRNYISGVGADSFAVQEAAASGLKSIENFIGLMSRDSFNSDQPSSSSASASASAAADLESARNTTADAAVSKFKRVISLLDRTRTGHARFRRAPVHVISPVLLQEEPKTTPFQSPLPPPPQMIRKGSFSSSMKTIDFSSLSSVTTESDNQKKIHHHQRPSETAPFASQTQSLSTTVSSFSKSTKRKCNSENLLTGKCASASSSGRCHCSKKRKIKQRRIIRVPAISAKMSDVPPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERAADDSSMLIVTYEGDHNHSLSAADLAGAAVADLILESS 267882EC7035D606 wrk11_arath Probable WRKY transcription factor 11 WRKY11 WRKY DNA-binding protein 11 F3L17.120 At4g31550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVDLMRFPKIDDQTAIQEAASQGLQSMEHLIRVLSNRPEQQHNVDCSEITDFTVSKFKTVISLLNRTGHARFRRGPVHSTSSAASQKLQSQIVKNTQPEAPIVRTTTNHPQIVPPPSSVTLDFSKPSIFGTKAKSAELEFSKENFSVSLNSSFMSSAITGDGSVSNGKIFLASAPLQPVNSSGKPPLAGHPYRKRCLEHEHSESFSGKVSGSAYGKCHCKKSRKNRMKRTVRVPAISAKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDPAMLIVTYEGEHRHNQSAMQENISSSGINDLVFASA 2DB2B296D776EDC6 wrk17_arath Probable WRKY transcription factor 17 WRKY17 WRKY DNA-binding protein 17 F25P17.13 At2g24570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTVDIMRLPKMEDQTAIQEAASQGLKSMEHLIRVLSNRPEERNVDCSEITDFTVSKFKKVISLLNRSGHARFRRGPVHSPPSSSVPPPVKVTTPAPTQISAPAPVSFVQANQQSVTLDFTRPSVFGAKTKSSEVVEFAKESFSVSSNSSFMSSAITGDGSVSKGSSIFLAPAPAVPVTSSGKPPLSGLPYRKRCFEHDHSEGFSGKISGSGNGKCHCKKSRKNRMKRTVRVPAVSAKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDSTMLIVTYEGEHRHHQSTMQEHVTPSVSGLVFGSA 8425473535057ACE wrky7_arath Probable WRKY transcription factor 7 WRKY7 WRKY DNA-binding protein 7 T22A6.70 At4g24240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTVELMMSSYSGGGGGGDGFPAIAAAAKMEDTALREAASAGIHGVEEFLKLIGQSQQPTEKSQTEITAVTDVAVNSFKKVISLLGRSRTGHARFRRAPASTQTPFKQTPVVEEEVEVEEKKPETSSVLTKQKTEQYHGGGSAFRVYCPTPIHRRPPLSHNNNNNQNQTKNGSSSSSPPMLANGAPSTINFAPSPPVSATNSFMSSHRCDTDSTHMSSGFEFTNPSQLSGSRGKPPLSSASLKRRCNSSPSSRCHCSKKRKSRVKRVIRVPAVSSKMADIPSDEFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDAMMLIVTYEGDHNHALVLETTTMNHDKTL 8C3E3DB7E23883CA wrk74_arath Probable WRKY transcription factor 74 WRKY74 WRKY DNA-binding protein 74 F4I4.30 At5g28650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEVEAANKAAVESCHGVLNLLSQQTNDSKSIMVETREAVCKFKRVSSLLSRGLGQRKIKKLNNNNYKFSSSLLPQHMFLESPVCSNNAISGCIPILAPKPLQIVPAGPPPLMLFNQNMCLDKSFLELKPPSSRAVDPKPYQFIHTHQQGVYSRSKSGLNLKFDGSIGASCYSPSISNGSRSFVSSLSMDGSVTDYDRNSFHLIGLPQGSDHISQHSRRTSCSGSLKCGSKSKCHCSKKRKLRVKRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCVEETSMLIVTYEGEHNHSRILSSQSAHT 584661E7942B4782 q40828_petcr protein protein petcr Petroselinum crispum (Parsley) Petroselinum hortense MALDLMNNNSYKFRSKMEETAVQEAAAAGLQSVENLIKAISQSNHQTAYLSSSSSSETGDTDYRAVTDVAVNKFKKFISLLDKNRTGHARFRRGPVQEKTGVEMLVNPIQNQIQNHGSDGFQVYRPTAVHPVQPVQPVQIQPVQLVQPVQRLPPVPKKENISTTINFAAPAVAVAAPATSFMSSLTGDTDGSGFQITNMSGFSSGSRPVSSLKRKCSSMNDVSAKCSGSSSGRCHCPKKKKLRVKKVVRMPAISMKTSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERAVDDPTMLIVTYEGEHNHSQSSNENTNTSHILESDGLKQS 6FDD4C36123E8051 q9fxs1_tobac NtEIG-D48 LOC107788966 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAVELMTSGYSRRDSFSTKMEENAVQEAATAGLQSVEKLIRLLSQSHQNQQQQQQKLDQNPSVSADYTAVADVAVNKFKKFISLLDKNRTGHARFRKGPISTPLPPPPKPQQQRLNQNSIKNQNLQIEETEKPQINTPKIYCPTPIQRLPPLPHNHLQLVKNGSIERKESSTTINFASASPANSFMSSLTGETESLQQSLSSGFQITNLSTVSSAGRPPLSTSSFKRKCSSMDDTALKCNSAGGSSGRCHCPKKRKSRVKRVVRVPAISMKMADIPPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPTMLIVTYEGEHNHSHSITESPAAHVLESS 863F76E0EEA3068D wrk21_arath Probable WRKY transcription factor 21 WRKY21 At2g30590 T6B20.6 T06B20.6 WRKY DNA-binding protein 21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEIEGTNRAAVESCHRVLNLLHRSQQQDHVGFEKNLVSETREAVIRFKRVGSLLSSSVGHARFRRAKKLQSHVSQSLLLDPCQQRTTEVPSSSSQKTPVLRSGFQELSLRQPSDSLTLGTRSFSLNSNAKAPLLQLNQQTMPPSNYPTLFPVQQQQQQQQQQQQQEQQQQQQQQQQQFHERLQAHHLHQQQQLQKHQAELMLRKCNGGISLSFDNSSCTPTMSSTRSFVSSLSIDGSVANIEGKNSFHFGVPSSTDQNSLHSKRKCPLKGDEHGSLKCGSSSRCHCAKKRKHRVRRSIRVPAISNKVADIPPDDYSWRKYGQKPIKGSPYPRGYYKCSSMRGCPARKHVERCLEDPAMLIVTYEAEHNHPKLPSQAITT AEE49BFD6E6FD797 wrk39_arath Probable WRKY transcription factor 39 WRKY39 WRKY DNA-binding protein 39 F7O18.30 At3g04670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEVEAANRSAIESCHGVLNLLSQRTSDPKSLTVETGEVVSKFKRVASLLTRGLGHGKFRSTNKFRSSFPQHIFLESPICCGNDLSGDYTQVLAPEPLQMVPASAVYNEMEPKHQLGHPSLMLSHKMCVDKSFLELKPPPFRAPYQLIHNHQQIAYSRSNSGVNLKFDGSGSSCYTPSVSNGSRSFVSSLSMDASVTDYDRNSFHLTGLSRGSDQQHTRKMCSGSLKCGSRSKCHCSKKRKLRVKRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCIDETSMLIVTYEGEHNHSRILSSQSAHT 8AFB80E448F2B42C q9sxp4_tobac LOC107780047 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MAVDFIGFSKMNEQLALQEAASAGLKSMEHLIRLVSHQQQQQPVQLDCREITDFTLSKFKKVVSILDRTGHARFRRGPVQVHPDNFTSLSLSPSNQQLLNLAPAKETPPPPSVSLPLTALTLDFTKPNVDRPTGNSNAIVAVKSKETFCISTPMATSANSSSFMSSITGEGSVSNGKQGSSVFLPPAPSVSAGKPPISGKRCREHEPSEDISGKSNGSGKCHCKKRKSRVKKVVRIPAISSRIADIPGDEYSWRKYGQKPIKGSPYPRGYYKCSSVRGCPARKHVERAMDDPAMLIVTYEGEHRHTIGAMQENNTQMMVFGSTEERRE 1480F781D9C5DD76 calm2_arath Calmodulin-2/3/5 CAM2 CAL1 At2g41110 T3K9.12 CAM3 At3g56800 T8M16.130 CAM5 TCH1 At2g27030 T20P8.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFVKVMMAK 722B188A90AD423A cam2-wrky7 3 7 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association To isolate CaM-binding transcription factors in plants, we screened an Arabidopsis cDNA expression library using HRP-conjugated CaM as a probe (9). Fifty positive clones were obtained from about 5 X 105 recombinant phages. DNA sequencing of the clones and comparisons with known sequences in the GenBank database revealed known plant CaMBPs, such as kinesin-like proteins (13), CaM-binding heat-shock proteins [14] and two CaMBPs of unknown function. The 50 positive clones also included several novel CaMBPs with high homology to known proteins, and others with no significant homology to any reported proteins. From these, we obtained two cDNA clones that encode AtWRKY7, a WRKY transcription factor. cam2-wrky7-1 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1 To map the location of the CaMBD, full-length AtWRKY7 cDNA and five truncated versions were expressed in Escherichia coli as GST-tag fusions (Fig. 1A). The four proteins bearing the putative CaMBD (D0-D3) interacted with CaM::HRP in a Ca2+-dependent manner, unlike the proteins lacking this sequence (D4 and D5) (Fig. 1B). The authors concluded "the 17-amino acid stretch at the N-terminus of AtWRKY7, i.e., the C-region, (72VAVNSFKKVISLLGRSR88) may be its CaMBD" (Calmodulin binding domain) The interaction was calcium dependent. cam2-wrky7-3 2 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cbd region sufficient to bind sufficient binding region sufficient to bind electron resonance electron resonance certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1 To map the location of the CaMBD, full-length AtWRKY7 cDNA and five truncated versions were expressed in Escherichia coli as GST-tag fusions (Fig. 1A). The four proteins bearing the putative CaMBD (D0-D3) interacted with CaM::HRP in a Ca2+-dependent manner, unlike the proteins lacking this sequence (D4 and D5) (Fig. 1B). The authors concluded "the 17-amino acid stretch at the N-terminus of AtWRKY7, i.e., the C-region, (72VAVNSFKKVISLLGRSR88) may be its CaMBD" (Calmodulin binding domain) The interaction was calcium dependent. cam2-wrky7-4 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9STX0:p.Phe77Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F R Wed May 02 20:25:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe77arg' Tue Jun 30 18:18:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe77Arg' Q9STX0:p.Leu84Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L R Wed May 02 15:21:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu84arg' Tue Jun 30 18:55:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu84Arg' Q9STX0:p.[Phe77Arg;Leu84Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain F R Fri Jul 22 10:50:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu84arg,phe77arg' Wed May 02 16:44:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe77arg,leu84arg' Tue Jun 30 18:05:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe77Arg;Leu84Arg]' ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 3 The F77R and L84R variants showed reduced CaM binding, while the double-amino-acid mutant F77R/L84R did not bind CaM at all. Thus, the two hydrophobic amino acids F77 and L84 may be important in CaM binding. cam2-wrky7-6 1 14 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait Q9STX0:p.[Phe77Arg;Leu84Arg] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain F R Fri Jul 22 11:06:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu84arg,phe77arg' Wed May 02 16:40:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe77arg,leu84arg' Tue Jun 30 17:48:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe77Arg;Leu84Arg]' ecoli Escherichia coli (strain K12) physical association physical association Figure 4 Split-ubiquitin yeast assay using AtWRKY7 and CaM. AtWRKY7 interacts with CaM in vivo. cam2-wrky11 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5D cam2-wrky15 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5D cam2-wrky17 2 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5D cam2-wrky21 2 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5D cam2-wrky39 2 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5D The interaction was calcium dependent cam2-wrky74 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5D cam2-wrky3 2 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5D The interaction was calcium dependent. cam2-wrky3-1 2 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5D The interaction was calcium dependent. cam2-subd48 2 14 unspecified role unspecified role prey prey region hrp tag horseradish peroxidase tag hrp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5D The interaction was calcium dependent.