MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein. Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein. FEBS Lett. (0014-5793) 2004 imex curation Woo HN., Hong GS., Jun JI., Cho DH., Choi HW., Lee HJ., Chung CW., Kim IK., Jo DG., Pyo JO., Bertin J., Jung YK. Only protein-protein interactions imex curation in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Woo HN., Hong GS., Jun JI., Cho DH., Choi HW., Lee HJ., Chung CW., Kim IK., Jo DG., Pyo JO., Bertin J., Jung YK. no FEBS Lett. (0014-5793) 2004 IMEx Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein. Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein. FEBS Lett. (0014-5793) 2004 imex curation Woo HN., Hong GS., Jun JI., Cho DH., Choi HW., Lee HJ., Chung CW., Kim IK., Jo DG., Pyo JO., Bertin J., Jung YK. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Woo HN., Hong GS., Jun JI., Cho DH., Choi HW., Lee HJ., Chung CW., Kim IK., Jo DG., Pyo JO., Bertin J., Jung YK. no FEBS Lett. (0014-5793) 2004 IMEx Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein. Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein. FEBS Lett. (0014-5793) 2004 imex curation Woo HN., Hong GS., Jun JI., Cho DH., Choi HW., Lee HJ., Chung CW., Kim IK., Jo DG., Pyo JO., Bertin J., Jung YK. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Woo HN., Hong GS., Jun JI., Cho DH., Choi HW., Lee HJ., Chung CW., Kim IK., Jo DG., Pyo JO., Bertin J., Jung YK. no FEBS Lett. (0014-5793) 2004 IMEx Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein. Inhibition of Bcl10-mediated activation of NF-kappa B by BinCARD, a Bcl10-interacting CARD protein. FEBS Lett. (0014-5793) 2004 imex curation Woo HN., Hong GS., Jun JI., Cho DH., Choi HW., Lee HJ., Chung CW., Kim IK., Jo DG., Pyo JO., Bertin J., Jung YK. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Woo HN., Hong GS., Jun JI., Cho DH., Choi HW., Lee HJ., Chung CW., Kim IK., Jo DG., Pyo JO., Bertin J., Jung YK. no FEBS Lett. (0014-5793) 2004 IMEx car19_human Caspase recruitment domain-containing protein 19 C9orf89 CARD19 Bcl10-interacting CARD protein protein protein human Homo sapiens Human MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALRKFHITNHACLVLARGGHPSLPLMAWMSSMTTQVCCSPGLASPLASAPPQRPPSGPEGRVWQAQAVQMLVSVSHFLPLPPSLSHGSFHTAWGILYVHSCPSFSNLIPRGSLHVCVDSNLVPTAAWRS mint Plays a role in inhibiting the effects of BCL10-induced activation of NF-kappa-B. May inhibit the phosphorylation of BCL10 in a CARD-dependent manner 7A58F5AB69882CF8 bcl10_human B-cell lymphoma/leukemia 10 BCL10 CIPER CLAP Cellular homolog of vCARMEN Mammalian CARD-containing adapter molecule E10 Cellular-E10 CARD-like apoptotic protein B-cell CLL/lymphoma 10 CED-3/ICH-1 prodomain homologous E10-like regulator CARD-containing molecule enhancing NF-kappa-B protein protein human Homo sapiens Human MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ DIP protein O95999 original sequence version: 69 DIP protein O95999 original sequence version: 122 DIP protein O95999 original sequence version: 60 DIP protein O95999 original sequence version: 86 F87C97F2B784BA4B bcl10-c9orf89-4 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 6 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3D FEBS-Letters homomint mint bcl10-c9orf89-1 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3C FEBS-Letters homomint mint c9orf89-bcl10-1 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1215146: original sequence: 18-102 : KDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITD Stoichiometry: 1.0 physical association physical association F3B FEBS-Letters homomint mint bcl10-c9orf89-3 4 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed Stoichiometry: 1.0 6 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F3E FEBS-Letters homomint mint