IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Myotonic dystrophy protein kinase phosphorylates phospholamban and regulates calcium uptake in cardiomyocyte sarcoplasmic reticulum. Myotonic dystrophy protein kinase phosphorylates phospholamban and regulates calcium uptake in cardiomyocyte sarcoplasmic reticulum. J. Biol. Chem. (0021-9258) 2005 Kaliman P., Catalucci D., Lam JT., Kondo R., Gutierrez JC., Reddy S., Palacin M., Zorzano A., Chien KR., Ruiz-Lozano P. 3A & B p.kaliman@ub.edu human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Kaliman P., Catalucci D., Lam JT., Kondo R., Gutierrez JC., Reddy S., Palacin M., Zorzano A., Chien KR., Ruiz-Lozano P. 3A & B p.kaliman@ub.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2005 Myotonic dystrophy protein kinase phosphorylates phospholamban and regulates calcium uptake in cardiomyocyte sarcoplasmic reticulum. Myotonic dystrophy protein kinase phosphorylates phospholamban and regulates calcium uptake in cardiomyocyte sarcoplasmic reticulum. J. Biol. Chem. (0021-9258) 2005 Kaliman P., Catalucci D., Lam JT., Kondo R., Gutierrez JC., Reddy S., Palacin M., Zorzano A., Chien KR., Ruiz-Lozano P. 3A & B p.kaliman@ub.edu in vitro In vitro protein kinase assay protein kinase assay monoclonal western monoclonal antibody western blot monoclonal western Kaliman P., Catalucci D., Lam JT., Kondo R., Gutierrez JC., Reddy S., Palacin M., Zorzano A., Chien KR., Ruiz-Lozano P. 3A & B p.kaliman@ub.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2005 dmpk_human Myotonin-protein kinase Myotonic dystrophy protein kinase DMPK DM-kinase DMPK MDPK DM1 protein kinase DM1PK protein protein human Homo sapiens Human MSAEVRLRRLQQLVLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVRLKEVRLQRDDFEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREERDVLVNGDRRWITQLHFAFQDENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTPMELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVLTRQSLSREMEAIRTDNQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPSPRATDPPSHLDGPPAVAVGQCPLVGPGPMHRRHLLLPARVPRPGLSEALSLLLFAVVLSRAAALGCIGLVAHAGQLTAVWRRPGAARAP 46783ED4AE65B493 ppla_human Cardiac phospholamban PLN PLB protein protein human Homo sapiens Human MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL DIP protein P26678 original sequence version: 151 0766304A76A854D3 dmpk-pln-1 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 enzyme enzyme unspecified role unspecified role ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Phosphorylation of phospholamban on Ser-16 Mutation of DMPK Lys-110 to alanine results in loss of kinase activity dmpk-pln-2 2 4 enzyme target enzyme target substrate substrate unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 3 enzyme enzyme unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 phosphorylation phosphorylation reaction phosphorylation Phosphorylation of phospholamban on Ser-16 dmpk-pln-3 1 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation dmpk-pln-4 1 3 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation