IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel molecular recognition motif necessary for targeting photoactivated phytochrome signaling to specific basic helix-loop-helix transcription factors. A novel molecular recognition motif necessary for targeting photoactivated phytochrome signaling to specific basic helix-loop-helix transcription factors. Plant Cell (1040-4651) 2004 Khanna R., Huq E., Kikis EA., Al-Sady B., Lanzatella C., Quail PH. Figure 1 (a) to (c). Figure 4 (a) and (b). Figure 5 (a) and (b) quail@nature.berkeley.edu in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Khanna R., Huq E., Kikis EA., Al-Sady B., Lanzatella C., Quail PH. Figure 1 (a) to (c). Figure 4 (a) and (b). Figure 5 (a) and (b) quail@nature.berkeley.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Plant Cell (1040-4651) 2004 q8w2f3-2 Transcription factor PIF4 PIF4 BHLH9 EN102 SRL2 Basic helix-loop-helix protein 9 Phytochrome-interacting factor 4 Short under red-light 2 Transcription factor EN 102 bHLH transcription factor bHLH009 MFL8.13 At2g43010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEHQGWSFEENYSLSTNRRSIRPQDELVELLWRDGQVVLQSQTHREQTQTQKQDHHEEALRSSTFLEDQETVSWIQYPPDEDPFEPDDFSSHFFSTMDPLQRPTSETVKPKSSPEPPQVMVKPKACPDPPPQVMPPPKFRLTNSSSGIRETEMEQYSVTTVGPSHCGSNPSQNDLDVSMSHDRSKNIEEKLNPNASSSSGGSSGCSFGKDIKEMASGRCITTDRKRKRINHTDESVSLSDAIGNKSNQRSGSNRRSRAAEVHNLSERVLHRFVYIIYNI B722C3E8EB999D44 pif3_arath Transcription factor PIF3 Phytochrome-associated protein 3 Basic helix-loop-helix protein 8 PIF3 PAP3 BHLH8 At1g09530 F14J9.19 Transcription factor EN 100 bHLH transcription factor bHLH008 Phytochrome-interacting factor 3 EN100 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPLFELFRLTKAKLESAQDRNPSPPVDEVVELVWENGQISTQSQSSRSRNIPPPQANSSRAREIGNGSKTTMVDEIPMSVPSLMTGLSQDDDFVPWLNHHPSLDGYCSDFLRDVSSPVTVNEQESDMAVNQTAFPLFQRRKDGNESAPAASSSQYNGFQSHSLYGSDRARDLPSQQTNPDRFTQTQEPLITSNKPSLVNFSHFLRPATFAKTTNNNLHDTKEKSPQSPPNVFQTRVLGAKDSEDKVLNESVASATPKDNQKACLISEDSCRKDQESEKAVVCSSVGSGNSLDGPSESPSLSLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKSLQLQVQIMSMASGYYLPPAVMFPPGMGHYPAAAAAMAMGMGMPYAMGLPDLSRGGSSVNHGPQFQVSGMQQQPVAMGIPRVSGGGIFAGSSTIGNGSTRDLSGSKDQTTTNNNSNLKPIKRKQGSSDQFCGSS DIP protein O80536 original sequence version: 116 DIP protein O80536 original sequence version: 85 1044AC01D598DE7C phyb_arath Phytochrome B PHYB HY3 OOP1 Protein LONG HYPOCOTYL 3 Protein OUT OF PHASE 1 MSF3.17 At2g18790 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSLRPRSNTESMSKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQQITAYLSRIQRGGYIQPFGCMIAVDESSFRIIGYSENAREMLGIMPQSVPTLEKPEILAMGTDVRSLFTSSSSILLERAFVAREITLLNPVWIHSKNTGKPFYAILHRIDVGVVIDLEPARTEDPALSIAGAVQSQKLAVRAISQLQALPGGDIKLLCDTVVESVRDLTGYDRVMVYKFHEDEHGEVVAESKRDDLEPYIGLHYPATDIPQASRFLFKQNRVRMIVDCNATPVLVVQDDRLTQSMCLVGSTLRAPHGCHSQYMANMGSIASLAMAVIINGNEDDGSNVASGRSSMRLWGLVVCHHTSSRCIPFPLRYACEFLMQAFGLQLNMELQLALQMSEKRVLRTQTLLCDMLLRDSPAGIVTQSPSIMDLVKCDGAAFLYHGKYYPLGVAPSEVQIKDVVEWLLANHADSTGLSTDSLGDAGYPGAAALGDAVCGMAVAYITKRDFLFWFRSHTAKEIKWGGAKHHPEDKDDGQRMHPRSSFQAFLEVVKSRSQPWETAEMDAIHSLQLILRDSFKESEAAMNSKVVDGVVQPCRDMAGEQGIDELGAVAREMVRLIETATVPIFAVDAGGCINGWNAKIAELTGLSVEEAMGKSLVSDLIYKENEATVNKLLSRALRGDEEKNVEVKLKTFSPELQGKAVFVVVNACSSKDYLNNIVGVCFVGQDVTSQKIVMDKFINIQGDYKAIVHSPNPLIPPIFAADENTCCLEWNMAMEKLTGWSRSEVIGKMIVGEVFGSCCMLKGPDALTKFMIVLHNAIGGQDTDKFPFPFFDRNGKFVQALLTANKRVSLEGKVIGAFCFLQIPSPELQQALAVQRRQDTECFTKAKELAYICQVIKNPLSGMRFANSLLEATDLNEDQKQLLETSVSCEKQISRIVGDMDLESIEDGSFVLKREEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRYAPSQEWVEIHLSQLSKQMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGLGLSVCRKILKLMNGEVQYIRESERSYFLIILELPVPRKRPLSTASGSGDMMLMMPY DIP protein P14713 original sequence version: 107 DIP protein P14713 original sequence version: 131 7B5348CB1091B813 pif5_arath Transcription factor PIF5 PIL6 Basic helix-loop-helix protein 65 Phytochrome interacting factor-like 6 F17J16.110 PIF5 EN103 Phytochrome-interacting factor 5 At3g59060 Transcription factor EN 103 BHLH65 bHLH transcription factor bHLH065 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEQVFADWNFEDNFHMSTNKRSIRPEDELVELLWRDGQVVLQSQARREPSVQVQTHKQETLRKPNNIFLDNQETVQKPNYAALDDQETVSWIQYPPDDVIDPFESEFSSHFFSSIDHLGGPEKPRTIEETVKHEAQAMAPPKFRSSVITVGPSHCGSNQSTNIHQATTLPVSMSDRSKNVEERLDTSSGGSSGCSYGRNNKETVSGTSVTIDRKRKHVMDADQESVSQSDIGLTSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTDKASILDEAIDYLKSLQMQLQVMWMGSGMAAAAAAAASPMMFPGVQSSPYINQMAMQSQMQLSQFPVMNRSAPQNHPGLVCQNPVQLQLQAQNQILSEQLARYMGGIPQMPPAGNQMQTVQQQPADMLGFGSPAGPQSQLSAPATTDSLHMGKIG 593D72C1F2ED86C7 pif6_arath Transcription factor PIF6 PIF6 Transcription factor EN 111 bHLH transcription factor bHLH132 Basic helix-loop-helix protein 132 T17J13.50 At3g62090 BHLH132 EN111 PIL2 Protein PHYTOCHROME-INTERACTING FACTOR 6 Protein PHYTOCHROME INTERACTING FACTOR 3-LIKE 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMFLPTDYCCRLSDQEYMELVFENGQILAKGQRSNVSLHNQRTKSIMDLYEAEYNEDFMKSIIHGGGGAITNLGDTQVVPQSHVAAAHETNMLESNKHVDDSETLKASSSKRMMVDYHNRKKIKFIPPDEQSVVADRSFKLGFDTSSVGFTEDSEGSMYLSSSLDDESDDARPQVPARTRKALVKRKRNAEAYNSPERNQRNDINKKMRTLQNLLPNSHKDDNESMLDEAINYMTNLQLQVQMMTMGNRFVTPSMMMPLGPNYSQMGLAMGVGMQMGEQQFLPAHVLGAGLPGINDSADMLRFLNHPGLMPMQNSAPFIPTENCSPQSVPPSCAAFPNQIPNPNSLSNLDGATLHKKSRKTNR 15AD124E07949873 pif5-phyb 1 4 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait gad tag GAL4 activation domain tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q84LH8:p.Glu31Ala Glutamine 31 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 20:28:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu31ala' Tue Jun 30 18:15:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu31Ala' Q84LH8:p.Leu32Ala Leucine 32 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:59:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu32ala' Tue Jun 30 16:30:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu32Ala' Q84LH8:p.Gly37Ala Glycine 37 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 19:58:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly37ala' Tue Jun 30 17:23:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly37Ala' Q84LH8:p.Gln38Ala Glutamine 38 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 16:50:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln38ala' Tue Jun 30 15:59:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln38Ala' s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Pif5 preferentially interacted with the Pfr form of PHYB All listed amino acid alterations within the PIF5 protein abolished interaction with PHYB. pif6-phyb-1 1 4 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait gad tag GAL4 activation domain tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q8L5W7:p.[Glu19Ala;Gly25Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:16:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu19ala,gly25ala' Tue Jun 30 16:39:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu19Ala;Gly25Ala]' s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association PIF6 preferentially interacted with the Pfr form of PHYB. Alteration of amino acid sequence abolished interaction between PIF6 and PHYB. pif3-phyb-4 1 3 unspecified role unspecified role bait bait gal4 region GAL4 activation domain tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O80536:p.[Glu31Ala;Gly37Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain E A Fri Jul 22 10:57:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gly37ala,glu31ala' Wed May 02 19:16:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu31ala,gly37ala' Tue Jun 30 16:55:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu31Ala;Gly37Ala]' s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association PIF3 preferentially interacts with the Pfr (biologically active) form of PhyB Gyl 37 ala and glu 31 ala mutations abolished interaction between PIF4 and PHYB. pif4-phyb-2 1 4 unspecified role unspecified role prey prey s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 2 unspecified role unspecified role bait bait gad GAL4 activation domain tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8W2F3-2:p.Gly35Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:57:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly35ala' Tue Jun 30 20:25:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly35Ala' Q8W2F3-2:p.[Glu29Ala;Gly35Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain G A Wed May 02 15:57:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu29ala,gly35ala' Tue Jun 30 16:14:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu29Ala;Gly35Ala]' region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association PIF4 preferentially interacts with the Pfr (biologically active) form of PhyB Amino acid alterations to PIF4 abolished PIF4 interaction with PHYB.