IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions between the nitrogen signal transduction protein PII and N-acetyl glutamate kinase in organisms that perform oxygenic photosynthesis. Interactions between the nitrogen signal transduction protein PII and N-acetyl glutamate kinase in organisms that perform oxygenic photosynthesis. J. Bacteriol. (0021-9193) 2004 Burillo S., Luque I., Fuentes I., Contreras A. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species fig 1A, 2 contrera@ua.es 29-Mar-2010: Contacted by JYOTI. Synechoccocus sp. PCC 7942 genomic library used. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Burillo S., Luque I., Fuentes I., Contreras A. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Two-hybrid positive results were classified into three groups: significant but weak signal, strong signal, very strong signal fig 1A, 2 contrera@ua.es Annotation to indicate that this entry has been checked and accepted by a senior curator. 29-Mar-2010: Contacted by JYOTI. Synechoccocus sp. PCC 7942 genomic library used. J. Bacteriol. (0021-9193) 2004 Interactions between the nitrogen signal transduction protein PII and N-acetyl glutamate kinase in organisms that perform oxygenic photosynthesis. Interactions between the nitrogen signal transduction protein PII and N-acetyl glutamate kinase in organisms that perform oxygenic photosynthesis. J. Bacteriol. (0021-9193) 2004 Burillo S., Luque I., Fuentes I., Contreras A. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species fig 1A, 2 contrera@ua.es 29-Mar-2010: Contacted by JYOTI. Synechoccocus sp. PCC 7942 genomic library used. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Burillo S., Luque I., Fuentes I., Contreras A. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species fig 1A, 2 contrera@ua.es Annotation to indicate that this entry has been checked and accepted by a senior curator. 29-Mar-2010: Contacted by JYOTI. Synechoccocus sp. PCC 7942 genomic library used. J. Bacteriol. (0021-9193) 2004 glnb_ecoli Nitrogen regulatory protein P-II 1 glnB b2553 JW2537 protein protein ecoli Escherichia coli (strain K12) MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI D1A4158A2F225042 glne_ecoli Bifunctional glutamine synthetase adenylyltransferase/adenylyl-removing enzyme glnE ATP:glutamine synthetase adenylyltransferase ATase JW3025 b3053 protein protein ecoli Escherichia coli (strain K12) MKPLSSPLQQYWQTVVERLPEPLAEESLSAQAKSVLTFSDFVQDSVIAHPEWLTELESQPPQADEWQHYAAWLQEALCNVSDEAGLMRELRLFRRRIMVRIAWAQTLALVTEESILQQLSYLAETLIVAARDWLYDACCREWGTPCNAQGEAQPLLILGMGKLGGGELNFSSDIDLIFAWPEHGCTQGGRRELDNAQFFTRMGQRLIKVLDQPTQDGFVYRVDMRLRPFGESGPLVLSFAALEDYYQEQGRDWERYAMVKARIMGDSEGVYANELRAMLRPFVFRRYIDFSVIQSLRNMKGMIAREVRRRGLTDNIKLGAGGIREIEFIVQVFQLIRGGREPSLQSRSLLPTLSAIAELHLLSENDAEQLRVAYLFLRRLENLLQSINDEQTQTLPSDELNRARLAWAMDFADWPQLTGALTAHMTNVRRVFNELIGDDESETQEESLSEQWRELWQDALQEDDTTPVLAHLSEDDRKQVLTLIADFRKELDKRTIGPRGRQVLDHLMPHLLSDVCAREDAAVTLSRITALLVGIVTRTTYLELLSEFPAALKHLISLCAASPMIASQLARYPLLLDELLDPNTLYQPTATDAYRDELRQYLLRVPEDDEEQQLEALRQFKQAQLLRIAAADIAGTLPVMKVSDHLTWLAEAMIDAVVQQAWVQMVARYGKPNHLNEREGRGFAVVGYGKLGGWELGYSSDLDLIFLHDCPMDAMTDGEREIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDARLRPSGAAGMLVTSAEAFADYQKNEAWTWEHQALVRARVVYGDPQLTAHFDAVRREIMTLPREGKTLQTEVREMREKMRAHLGNKHRDRFDIKADEGGITDIEFITQYLVLRYAHEKPKLTRWSDNVRILELLAQNDIMEEQEAMALTRAYTTLRDELHHLALQELPGHVSEDCFTAERELVRASWQKWLVEE 6FD2D7BDC619DB83 q7x386_syne7 Synpcc7942_2061 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MASENYLNHPTFGLLYQICSFGDSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVDNRLRQLRRDASLQEYNQLQQVFKQTFL DIP protein Q7X386 original sequence version: 37 314A9A0BA1F3E2D2 glnk_ecoli Nitrogen regulatory protein GlnK ybaI glnK b0450 JW0440 Nitrogen regulatory protein P-II 2 PII-like protein protein protein ecoli Escherichia coli (strain K12) MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL DIP protein P0AC55 original sequence version: 79 1875CD92C162B537 glnb_syne7 Nitrogen regulatory protein P-II PII signal transducing protein glnB Synpcc7942_0321 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADAI DIP protein P0A3F4 original sequence version: 31 DIP protein P0A3F4 original sequence version: 57 DIP protein P0A3F4 original sequence version: 52 5F44B64CBFF3C559 glnb_arath Nitrogen regulatory protein P-II homolog GLB1 GLNB1 At4g01900 Protein PII-like T7B11.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASMTKPISITSLGFYSDRKNIAFSDCISICSGFRHSRPSCLDLVTKSPSNNSRVLPVVSAQISSDYIPDSKFYKVEAIVRPWRIQQVSSALLKIGIRGVTVSDVRGFGAQGGSTERHGGSEFSEDKFVAKVKMEIVVKKDQVESVINTIIEGARTGEIGDGKIFVLPVSDVIRVRTGERGEKAEKMTGDMLSPS DIP protein Q9ZST4 original sequence version: 66 FE740EA66776F157 nagk_arath Acetylglutamate kinase, chloroplastic NAGK N-acetyl-L-glutamate 5-phosphotransferase NAG kinase T8H10.160 At3g57560 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATVTSNASPKSFSFTVSNPFKTLIPNKSPSLCYPTRNKNHHRLGFSIKATVSTPPSIATGNAPSPDYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG DIP protein Q9SCL7 original sequence version: 72 96F2C411A86DF531 ntrb_ecoli Sensory histidine kinase/phosphatase NtrB glnL glnR ntrB b3869 JW3840 Nitrogen regulation protein NR(II) Nitrogen regulator II protein protein ecoli Escherichia coli (strain K12) MATGTQPDAGQILNSLINSILLIDDNLAIHYANPAAQQLLAQSSRKLFGTPLPELLSYFSLNIELMQESLEAGQGFTDNEVTLVIDGRSHILSVTAQRMPDGMILLEMAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPSLLEYTKVIIEQADRLRNLVDRLLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGERYRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPIRK 8B6B3BB18B2E2E98 argb_syne7 Acetylglutamate kinase NAG kinase N-acetyl-L-glutamate 5-phosphotransferase argB Synpcc7942_1496 protein protein syne7 Synechococcus elongatus (strain PCC 7942) Anacystis nidulans R2 MSSEFIEAGAADRVRILSEALPYLQQFAGRTVVVKYGGAAMKQEELKEAVMRDIVFLACVGMRPVVVHGGGPEINAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPHDQEGIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTVAGEIAAALNAEKLILLTDTRGILEDPKRPESLIPRLNIPQSRELIAQGIVGGGMIPKVDCCIRSLAQGVRAAHIIDGRIPHALLLEIFTDAGIGTMIVGSGYHEAHQPWQ DIP protein Q6V1L5 original sequence version: 32 DIP protein Q6V1L5 original sequence version: 55 DIP protein Q6V1L5 original sequence version: 50 0652E306DEB1947B argb_ecoli Acetylglutamate kinase NAG kinase N-acetyl-L-glutamate 5-phosphotransferase argB b3959 JW5553 protein protein ecoli Escherichia coli (strain K12) MMNPLIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLPVKKKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHQIAAVGLFLGDGDSVKVTQLDEELGHVGLAQPGSPKLINSLLENGYLPVVSSIGVTDEGQLMNVNADQAATALAATLGADLILLSDVSGILDGKGQRIAEMTAAKAEQLIEQGIITDGMIVKVNAALDAARTLGRPVDIASWRHAEQLPALFNGMPMGTRILA DIP protein P0A6C8 original sequence version: 94 8B916B8CBC143738 glnd_ecoli Bifunctional uridylyltransferase/uridylyl-removing enzyme glnD Bifunctional [protein-PII] modification enzyme Bifunctional nitrogen sensor protein JW0162 b0167 protein protein ecoli Escherichia coli (strain K12) MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQRWLGDAFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLSDVDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLIESRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSSPGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVSRYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILALPADEKPRPIDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVHNSAITGIYSTTLRQLRHARRHLQQPLCNIPEARKLFLSILRHPGAVRRGLLPMHRHSVLGAYMPQWSHIVGQMQFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVDVWPRLPSTELIFIAALFHDIAKGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQFAEEVQTENRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDMRERVRHHQLQALALLRMDNIDEEALHQIWSRCRANYFVRHSPNQLAWHARHLLQHDLSKPLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFIVLEPDGNPLSADRHEVIRFGLEQVLTQSSWQPPQPRRQPAKLRHFTVETEVTFLPTHTDRKSFLELIALDQPGLLARVGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNNELQQEVHQRLTEALNPNDKG DIP protein P27249 original sequence version: null 6FF0006341A71D34 argb_porpu Acetylglutamate kinase NAG kinase N-acetyl-L-glutamate 5-phosphotransferase argB protein protein porpu Porphyra purpurea MLTNTERVKVLSDVTILQKFSSRIIVIKYGGAAMKNQKLKDHVISDLVFLSFIGLRPILVHGGGPEINFWLDQLKILPKFENGVRVTDQPTMDIVEMVLVGRVNKDLVASINKQGGKSVGLSGKDGLLITSRPSDKPNLGFVGEVQNVDTNLLEILINNNYIPVIASVAADKQGQSYNINADTVAGEIAARLNAEKLILLTDTPGILRNASDATTLISHLSIQEARDLTKTAVISGGMIPKVNCCIRSLAQGVASAHILDGRIDHALLLEILTDQGIGSMLVV 128225E06D5E4CE1 glnb-argb-1 2 11 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association glnb-glnb-1 1 7 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score strong signal argb-argb-1 1 11 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnb-argb-2 1 7 unspecified role unspecified role bait bait P0A3F4:p.Ser49Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S E Wed May 02 16:24:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser49glu' Tue Jun 30 18:08:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser49Glu' P0A3F4:p.Ser49Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S D Wed May 02 19:38:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser49asp' Tue Jun 30 15:37:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser49Asp' P0A3F4:p.Ser49Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:09:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser49ala' Tue Jun 30 16:58:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser49Ala' 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnb-argb-3 1 7 unspecified role unspecified role prey prey P0A3F4:p.Ser49Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S D Wed May 02 16:45:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser49asp' Tue Jun 30 18:11:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser49Asp' P0A3F4:p.Ser49Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:08:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser49ala' Tue Jun 30 18:01:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser49Ala' P0A3F4:p.Ser49Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S E Wed May 02 15:01:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser49glu' Tue Jun 30 18:16:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser49Glu' 11 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score strong signal glnb-pipx-1 1 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score very strong signal glnb-pipx-2 1 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score strong signal glnb-glnb-2 1 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal glnb-glnb-3 1 7 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal glnb-glnk-1 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnb-glnk-2 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal glnb-argb-4 1 12 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score strong signal argb-argb-2 1 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal glnb-glnb-4 1 3 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal glnb-glnk-3 1 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnb-glnk-4 1 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal glnk-glnk-1 1 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnb-glnd-1 1 13 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score strong signal glnb-glnd-2 1 13 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score strong signal glnb-glne-1 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score strong signal glnb-glne-2 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal glnd-glnk-2 1 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnd-glnk-1 1 6 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score strong signal glnb-ntrb-1 1 10 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score very strong signal glnb-ntrb-2 1 10 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score very strong signal glnk-ntrb-1 1 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score strong signal glnk-ntrb-2 1 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score very strong signal ntrb-ntrb-1 1 10 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score very strong signal glnb-glnb-9 1 3 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnb-argb-6 1 8 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnk-glnb-1 1 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal glnk-glnb-2 1 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal glnb-argb-7 1 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score very strong signal glnb-glnb-5 1 8 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal argb-argb-3 1 14 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnb-glnb-6 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal argb-argb-4 1 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal argb-glnb-1 1 14 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal argb-glnb-2 1 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal P69365 prey argb-glnb-3 1 14 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal argb-glnb-4 1 14 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score significant but weak signal argb-argb-5 1 14 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal glnb-glnb-7 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score significant but weak signal