MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Mona/Gads SH3C binding to hematopoietic progenitor kinase 1 (HPK1) combines an atypical SH3 binding motif, R/KXXK, with a classical PXXP motif embedded in a polyproline type II (PPII) helix. Mona/Gads SH3C binding to hematopoietic progenitor kinase 1 (HPK1) combines an atypical SH3 binding motif, R/KXXK, with a classical PXXP motif embedded in a polyproline type II (PPII) helix. J. Biol. Chem. (0021-9258) 2004 Lewitzky M., Harkiolaki M., Domart MC., Jones EY., Feller SM. no SH3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lewitzky M., Harkiolaki M., Domart MC., Jones EY., Feller SM. no SH3 J. Biol. Chem. (0021-9258) 2004 Mona/Gads SH3C binding to hematopoietic progenitor kinase 1 (HPK1) combines an atypical SH3 binding motif, R/KXXK, with a classical PXXP motif embedded in a polyproline type II (PPII) helix. Mona/Gads SH3C binding to hematopoietic progenitor kinase 1 (HPK1) combines an atypical SH3 binding motif, R/KXXK, with a classical PXXP motif embedded in a polyproline type II (PPII) helix. J. Biol. Chem. (0021-9258) 2004 Lewitzky M., Harkiolaki M., Domart MC., Jones EY., Feller SM. no SH3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lewitzky M., Harkiolaki M., Domart MC., Jones EY., Feller SM. no SH3 J. Biol. Chem. (0021-9258) 2004 m4k1_human Mitogen-activated protein kinase kinase kinase kinase 1 HPK1 MAP4K1 MAPK/ERK kinase kinase kinase 1 Hematopoietic progenitor kinase protein protein human Homo sapiens Human MDVVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDAGEVRLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPSDEGPGSMGDDGQLSPGVLVRCASGPPPNSPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMKRKGCALLVKLFNGCPLRIHSTAAWTHPSTKDQHLLLGAEEGIFILNRNDQEATLEMLFPSRTTWVYSINNVLMSLSGKTPHLYSHSILGLLERKETRAGNPIAHISPHRLLARKNMVSTKIQDTKGCRACCVAEGASSGGPFLCGALETSVVLLQWYQPMNKFLLVRQVLFPLPTPLSVFALLTGPGSELPAVCIGVSPGRPGKSVLFHTVRFGALSCWLGEMSTEHRGPVQVTQVEEDMVMVLMDGSVKLVTPEGSPVRGLRTPEIPMTEAVEAVAMVGGQLQAFWKHGVQVWALGSDQLLQELRDPTLTFRLLGSPRLECSGTISPHCNLLLPGSSNSPASASRVAGITGL DIP protein Q92918 original sequence version: 96 3C98CF01BE42E151 m4k1_mouse Mitogen-activated protein kinase kinase kinase kinase 1 Map4k1 Hpk1 MAPK/ERK kinase kinase kinase 1 Hematopoietic progenitor kinase protein protein mouse Mus musculus Mouse MALVDPDIFNKDPREHYDLLQRLGGGTYGEVFKARDKVSKDLVALKMVKMEPDDDVATLQKEILMLKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSEKKIHRDIKGANILINDCGEVKLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKSRWSSSFHNFVKVTLTKNSKKRPSATKMLSHQLVSQPGLNRGLILDLLDKMKNPGKGLPVDIEDEEPEPPPAIPRRIRSTYRASSLGIPDADCCRRQMEFQRPRCVDCRPQAETVRLYPPAHFGSTSPRSQLSDSDDDYDDVDIPAPSENIPPPLPPKPKFRSPSDDGSGGIRDDGQLSPGVLVRCASGPPPRTPRPGPPPATCSPHLTARSDPSLWNPAAPEPGQPPLVPPRKEKMRGKMENEKRREKYPLLVKLFNGCPLQIHSTAAWTHPSTKDQNLLLGAEEGIFILNRNDQEATLEMIFPGRTTWLYCINNLLMSLSGKTPYLYSHSILGLLERKDGRTGSPIAHISPHRLLARKNMVSSKIQDTKGCRACCVAESASSGGPFLCGALETSVVLLQWYQPMNKFLLVRQVLFPLPTPLPVFTLLTTPGSELPAVCIGVSPGQAAKSVLFHTVRFGALSCWLDDSSTEHKGPVQVIQVKEDMVMVLMDGSLKLVTPEGAPAPGLRTPEIPMTEAVEAVAMVEDRLEAFWKHGVQVWAPGLKQPLQELRDPTLTFRLLCSPRPVVVETRPTDDPTAPSNLYIQE DIP protein P70218 original sequence version: 89 82341BE9D13036BA grap2_mouse GRB2-related adaptor protein 2 GADS protein Growth factor receptor-binding protein GRBLG GRB-2-like protein Hematopoietic cell-associated adaptor protein GrpL GRB-2-related monocytic adapter protein Adapter protein GRID Grap2 Gads Grb2l Grid Mona protein protein mouse Mus musculus Mouse MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR DIP protein O89100 original sequence version: 91 736311D0640CD3D0 grap2-map4k1 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain proline rich range MINT-1176233: original sequence: 459-484 : WNPPSRELDKPPLLPPKKEKMKRKG Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1176223: original sequence: 256-322 : PVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMM Stoichiometry: 1.0 direct interaction direct interaction T1 20.8 micromolar homomint mint grap2-map4k1-1 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1176267: original sequence: 256-322 : PVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMM Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:45:49 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing ' range MINT-1176280: original sequence: 468-468 : NPAAPEPGQPPLVPPRKEKM range MINT-1176281: original sequence: 470-470 : AAPEPGQPPLVPPRKEKMRG range MINT-1176282: original sequence: 471-471 : APEPGQPPLVPPRKEKMRGK range MINT-1176283: original sequence: 473-473 : EPGQPPLVPPRKEKMRGKME range MINT-1176284: original sequence: 476-476 : QPPLVPPRKEKMRGKMENEK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain proline rich range MINT-1176277: original sequence: 465-480 : GQPPLVPPRKEKMRG Stoichiometry: 1.0 direct interaction direct interaction T1 2.4 micromolar homomint mint grap2-map4k1-2 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain proline rich range MINT-1176307: original sequence: 465-480 : GQPPLVPPRKEKMRG Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1176297: original sequence: 256-322 : PVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMM tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction T2 F2 homomint mint