IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Dimerization of the transmembrane domain of Integrin alphaIIb subunit in cell membranes. Dimerization of the transmembrane domain of Integrin alphaIIb subunit in cell membranes. J. Biol. Chem. (0021-9258) 2004 imex curation Li R., Gorelik R., Nanda V., Law PB., Lear JD., DeGrado WF., Bennett JS. TOXCAT: The chimeric protein consiting of an amino-terminal ToxR' DNA binding domain , a transmembrain domain of interest and a MBP tag. The dimerization was tested by MalE complementation and quantified using CAT (Chloramphenicol Acetyltransferase) ELISA. The orientation in the E. coli membrane of each ToxR-TM-MBP chimeric proteins were checked by proteinase digestion of spheroblasts. fig 2, fig 3, fig 4, fig 6 bennetts@mail.med.upenn.edu Only protein-protein interactions imex curation in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by staining molecular weight estimation by staining weight by staining Li R., Gorelik R., Nanda V., Law PB., Lear JD., DeGrado WF., Bennett JS. TOXCAT: The chimeric protein consiting of an amino-terminal ToxR' DNA binding domain , a transmembrain domain of interest and a MBP tag. The dimerization was tested by MalE complementation and quantified using CAT (Chloramphenicol Acetyltransferase) ELISA. The orientation in the E. coli membrane of each ToxR-TM-MBP chimeric proteins were checked by proteinase digestion of spheroblasts. fig 2, fig 3, fig 4, fig 6 bennetts@mail.med.upenn.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 IMEx Dimerization of the transmembrane domain of Integrin alphaIIb subunit in cell membranes. Dimerization of the transmembrane domain of Integrin alphaIIb subunit in cell membranes. J. Biol. Chem. (0021-9258) 2004 imex curation Li R., Gorelik R., Nanda V., Law PB., Lear JD., DeGrado WF., Bennett JS. TOXCAT: The chimeric protein consiting of an amino-terminal ToxR' DNA binding domain , a transmembrain domain of interest and a MBP tag. The dimerization was tested by MalE complementation and quantified using CAT (Chloramphenicol Acetyltransferase) ELISA. The orientation in the E. coli membrane of each ToxR-TM-MBP chimeric proteins were checked by proteinase digestion of spheroblasts. fig 2, fig 3, fig 4, fig 6 bennetts@mail.med.upenn.edu Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) toxcat tox-r dimerization assay toxcat elisa enzyme linked immunosorbent assay ELISA ELISA elisa Li R., Gorelik R., Nanda V., Law PB., Lear JD., DeGrado WF., Bennett JS. TOXCAT: The chimeric protein consiting of an amino-terminal ToxR' DNA binding domain , a transmembrain domain of interest and a MBP tag. The dimerization was tested by MalE complementation and quantified using CAT (Chloramphenicol Acetyltransferase) ELISA. The orientation in the E. coli membrane of each ToxR-TM-MBP chimeric proteins were checked by proteinase digestion of spheroblasts. fig 2, fig 3, fig 4, fig 6 bennetts@mail.med.upenn.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 IMEx Dimerization of the transmembrane domain of Integrin alphaIIb subunit in cell membranes. Dimerization of the transmembrane domain of Integrin alphaIIb subunit in cell membranes. J. Biol. Chem. (0021-9258) 2004 imex curation Li R., Gorelik R., Nanda V., Law PB., Lear JD., DeGrado WF., Bennett JS. TOXCAT: The chimeric protein consiting of an amino-terminal ToxR' DNA binding domain , a transmembrain domain of interest and a MBP tag. The dimerization was tested by MalE complementation and quantified using CAT (Chloramphenicol Acetyltransferase) ELISA. The orientation in the E. coli membrane of each ToxR-TM-MBP chimeric proteins were checked by proteinase digestion of spheroblasts. fig 2, fig 3, fig 4, fig 6 bennetts@mail.med.upenn.edu Only protein-protein interactions imex curation in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Li R., Gorelik R., Nanda V., Law PB., Lear JD., DeGrado WF., Bennett JS. TOXCAT: The chimeric protein consiting of an amino-terminal ToxR' DNA binding domain , a transmembrain domain of interest and a MBP tag. The dimerization was tested by MalE complementation and quantified using CAT (Chloramphenicol Acetyltransferase) ELISA. The orientation in the E. coli membrane of each ToxR-TM-MBP chimeric proteins were checked by proteinase digestion of spheroblasts. fig 2, fig 3, fig 4, fig 6 bennetts@mail.med.upenn.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 IMEx ita2b_human Integrin alpha-IIb Platelet membrane glycoprotein IIb GPalpha IIb ITGA2B GP2B ITGAB protein protein human Homo sapiens Human MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE 063EE298E026F116 glpa_human Glycophorin-A PAS-2 Sialoglycoprotein alpha MN sialoglycoprotein GYPA GPA protein protein human Homo sapiens Human MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ 48A5450E22FA99C9 gypa-gypa-1 2 5 unspecified role unspecified role bait bait transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P02724:p.Gly102Ile mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G I Wed May 02 18:24:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly102ile' Tue Jun 30 19:37:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly102Ile' mbp tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range toxr tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gly102ile sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mbp tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range toxr tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 8 physical association physical association Fig. 3 itga2b-itga2b-1 2 4 unspecified role unspecified role bait bait P08514:p.Gly1003Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G V Wed May 02 18:41:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1003val' Tue Jun 30 17:34:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1003Val' P08514:p.Gly1006Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G L Wed May 02 19:58:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1006leu' Tue Jun 30 16:04:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1006Leu' P08514:p.Met1018Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain M L Wed May 02 19:35:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1018leu' Tue Jun 30 16:14:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1018Leu' transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08514:p.Val1000Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V L Wed May 02 19:01:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1000leu' Tue Jun 30 17:27:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1000Leu' P08514:p.Gly1003Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G L Wed May 02 14:35:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1003leu' Tue Jun 30 17:28:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1003Leu' P08514:p.Gly1006Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G V Wed May 02 18:15:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1006val' Tue Jun 30 20:25:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1006Val' P08514:p.Val1004Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V L Wed May 02 19:51:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1004leu' Tue Jun 30 19:13:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1004Leu' P08514:p.Thr1012Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T L Wed May 02 17:18:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr1012leu' Wed May 02 17:59:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr1012leu' Tue Jun 30 17:28:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1012Leu' P08514:p.Ala1017Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A V Wed May 02 16:00:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala1017val' Tue Jun 30 18:56:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala1017Val' P08514:p.Leu1001Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:39:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1001ala' Tue Jun 30 17:38:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1001Ala' P08514:p.Val1002Ile mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain V I Wed May 02 15:31:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1002ile' Tue Jun 30 19:14:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1002Ile' P08514:p.Gly1003Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:44:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1003ala' Tue Jun 30 16:06:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1003Ala' P08514:p.Leu1014Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:16:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1014ala' Tue Jun 30 18:42:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1014Ala' P08514:p.Val1015Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V L Wed May 02 14:39:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1015leu' Tue Jun 30 18:59:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1015Leu' leu1011val mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain L V Wed Jul 06 15:05:39 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'leu1011val' P08514:p.Thr1012Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T L Wed May 02 17:55:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr1012leu' Tue Jun 30 16:12:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1012Leu' P08514:p.Thr1012Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 18:40:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr1012ala' Tue Jun 30 16:41:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1012Ala' P08514:p.Ala1017Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A L Wed May 02 15:33:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala1017leu' Tue Jun 30 17:03:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala1017Leu' P08514:p.Val1002Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A Wed May 02 15:29:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1002ala' Tue Jun 30 15:53:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1002Ala' P08514:p.Val1002Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V L Wed May 02 15:57:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val1002leu' Tue Jun 30 19:01:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1002Leu' P08514:p.Gly1007Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:49:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1007ala' Tue Jun 30 19:19:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1007Ala' P08514:p.Gly1007Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G L Wed May 02 15:57:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1007leu' Tue Jun 30 19:49:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1007Leu' P08514:p.Gly1007Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G V Wed May 02 16:40:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1007val' Tue Jun 30 19:09:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1007Val' P08514:p.Leu1011Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:17:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1011ala' Tue Jun 30 19:38:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1011Ala' P08514:p.Ile1013Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I L Fri Jul 22 11:03:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1013lue' Wed May 02 15:40:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile1013leu' Tue Jun 30 18:42:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile1013Leu' P08514:p.Gly1003Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G V Wed May 02 19:30:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1003val' Tue Jun 30 17:20:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1003Val' 4 unspecified role unspecified role prey prey transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 22 47 physical association physical association Fig. 5 The orientation of the alpha II b integrin transmembrane helix in the bacterial membrane of E. coli is opposite to its orientation in eukaryotic membranes. The residues preceding the the critical glycines GXXXG are important for dimerization whereas the succeeding residues were found to be substantially more mutable. itga2b-itga2b-2 1 4 unspecified role unspecified role neutral component neutral component tm-cyto region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08514:p.Leu1011Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:51:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1011ala' Tue Jun 30 16:06:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1011Ala' P08514:p.Gly1007Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G L Wed May 02 18:14:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1007leu' Tue Jun 30 17:43:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1007Leu' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component tm-cyto region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08514:p.Leu1011Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 14:52:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1011ala' Tue Jun 30 19:15:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1011Ala' P08514:p.Gly1007Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G L Wed May 02 20:27:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1007leu' Tue Jun 30 18:37:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1007Leu' ecoli Escherichia coli (strain K12) 50 54 direct interaction direct interaction Fig. 7A The oligomerization of alpha II b integrin fragment containing the transmembrane region and the cytoplasmic region is only detected as a dimer on SDS-PAGE. The mutation Leu1011Ala increases the oligomerization and a faint band of trimer is also detected. itga2b-itga2b-3 3 4 unspecified role unspecified role neutral component neutral component P08514:p.Leu1011Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 20:02:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1011ala' Tue Jun 30 20:15:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1011Ala' P08514:p.Gly1003Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G L Wed May 02 20:05:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1003leu' Tue Jun 30 17:48:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1003Leu' P08514:p.Gly1007Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G L Wed May 02 15:42:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1007leu' Tue Jun 30 19:50:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1007Leu' tm-cyto region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component tm-cyto region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08514:p.Leu1011Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:04:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu1011ala' Tue Jun 30 18:02:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu1011Ala' P08514:p.Gly1003Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G L Wed May 02 16:44:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1003leu' Tue Jun 30 20:11:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1003Leu' P08514:p.Gly1007Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G L Wed May 02 16:09:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly1007leu' Tue Jun 30 19:21:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly1007Leu' ecoli Escherichia coli (strain K12) direct interaction direct interaction The data of oligomerization of alpha II b integrin fragment containing the transmembrane region and the cytoplasmic region is best fitted with a monomer-dimer equilibrium. The mutant Leu1011Ala data could also be fitted with a monomere-dimer-trimer equilibrium.