IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular analyses of the Arabidopsis TUBBY-like protein gene family. Molecular analyses of the Arabidopsis TUBBY-like protein gene family. Plant Physiol. (0032-0889) 2004 Lai CP., Lee CL., Chen PH., Wu SH., Yang CC., Shaw JF. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lai CP., Lee CL., Chen PH., Wu SH., Yang CC., Shaw JF. Plant Physiol. (0032-0889) 2004 skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE DIP protein Q39255 original sequence version: 115 DIP protein Q39255 original sequence version: 118 DIP protein Q39255 original sequence version: 108 DIP protein Q39255 original sequence version: 88 DIP protein Q39255 original sequence version: 100 56B84C19FD5ABF17 tlp9_arath Tubby-like F-box protein 9 At3g06380 TULP9 F24P17.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTFRSLLQEMRSRPHRVVHAAASTANSSDPFSWSELPEELLREILIRVETVDGGDWPSRRNVVACAGVCRSWRILTKEIVAVPEFSSKLTFPISLKQSGPRDSLVQCFIKRNRNTQSYHLYLGLTTSLTDNGKFLLAASKLKRATCTDYIISLRSDDISKRSNAYLGRMRSNFLGTKFTVFDGSQTGAAKMQKSRSSNFIKVSPRVPQGSYPIAHISYELNVLGSRGPRRMRCIMDTIPMSIVESRGVVASTSISSFSSRSSPVFRSHSKPLRSNSASCSDSGNNLGDPPLVLSNKAPRWHEQLRCWCLNFHGRVTVASVKNFQLVAVSDCEAGQTSERIILQFGKVGKDMFTMDYGYPISAFQAFAICLSSFETRIACE EDB57859F8B5F51D tulp9-ask1 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association