IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. Mol. Biol. Cell (1059-1524) 2004 Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov Mol. Biol. Cell (1059-1524) 2004 WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. Mol. Biol. Cell (1059-1524) 2004 Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov Mol. Biol. Cell (1059-1524) 2004 WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. Mol. Biol. Cell (1059-1524) 2004 Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov Mol. Biol. Cell (1059-1524) 2004 WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. Mol. Biol. Cell (1059-1524) 2004 Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov Mol. Biol. Cell (1059-1524) 2004 WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. Mol. Biol. Cell (1059-1524) 2004 Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift predetermined predetermined participant predetermined Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov Mol. Biol. Cell (1059-1524) 2004 WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. WRN helicase and FEN-1 form a complex upon replication arrest and together process branchmigrating DNA structures associated with the replication fork. Mol. Biol. Cell (1059-1524) 2004 Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Sharma S., Otterlei M., Sommers JA., Driscoll HC., Dianov GL., Kao HI., Bambara RA., Brosh RM. Cells were treated with MMC (DNA-damaging agent mitomycin C) which causes replication arrest. fig 2b BroshR@grc.nia.nih.gov Mol. Biol. Cell (1059-1524) 2004 12.1 holiday junction Synthetic holiday junction ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) GACGCTGCCGAATTCTGGCTTGCTAGGACACATCTTGCCCACGTTGACCCG wrn_human Werner syndrome ATP-dependent helicase WRN RECQ3 RECQL2 Exonuclease WRN RecQ protein-like 2 DNA helicase, RecQ-like type 3 protein protein human Homo sapiens Human MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRRVSILLKDISENLYSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGEDVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYKSTEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLENLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQANEELCPKKLLLPSSKTVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISSGSNISKKSIMVQSPEKAYSSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS DIP protein Q14191 original sequence version: 125 DIP protein Q14191 original sequence version: 175 63F10D19E90AA461 pcna_human Proliferating cell nuclear antigen PCNA Cyclin protein protein human Homo sapiens Human MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS DIP protein P12004 original sequence version: 200 DIP protein P12004 original sequence version: 128 DIP protein P12004 original sequence version: 139 DIP protein P12004 original sequence version: 185 DIP protein P12004 original sequence version: 102 DIP protein P12004 original sequence version: 105 DIP protein P12004 original sequence version: 158 E6F08E7EDBC48B00 fen1_human Flap endonuclease 1 Flap structure-specific endonuclease 1 Maturation factor 1 DNase IV FEN1 RAD2 protein protein human Homo sapiens Human MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK DIP protein P39748 original sequence version: 106 DIP protein P39748 original sequence version: 112 DIP protein P39748 original sequence version: 160 5154F2F6E57592C5 wrn-fen1-6 6 10 unspecified role unspecified role fluorescence donor fluorescence donor ecfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept eyfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction FRET observed at nuclear foci representing the arrested replication forks pcna-fen1-7 6 10 unspecified role unspecified role fluorescence donor fluorescence donor ecfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept eyfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction FRET observed at nuclear foci representing the arrested replication forks wrn-fen1-7 4 8 unspecified role unspecified role neutral component neutral component eyfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role neutral component neutral component ecfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Colocalization is observed at nuclear foci representing the arrested replication forks Replication arrest caused by MMC treatment (DNA-damaging agent mitomycin C) stimulates colocalization signal in nuclear foci Treatment with chemical carcinogen 4-NQO enhanced colocalization in nuclear foci FRET is calculated from the mean of the intensities within one region of interest (ROI) containing more than 25 pixels (i.e., one replication focus). N-FRET represents FRET normalized against proteins expression levels. N-FRET mean on 5 experiments: 0.362. pcna-fen1-8 2 9 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept eyfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role fluorescence donor fluorescence donor ecfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Colocalization observed at nuclear foci representing the arrested replication forks Replication arrest caused by MMC treatment (DNA-damaging agent mitomycin C) stimulates clolocalization FRET signal in nuclear foci FRET is calculated from the mean of the intensities within one region of interest (ROI) containing more than 25 pixels (i.e., one replication focus). N-FRET represents FRET normalized against proteins expression levels. N-FRET mean on 5 experiments: 0.492. 12_1_holiday_junction-fen1 5 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association wrn-fen1-9 1 8 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association wrn-fen1-10 3 8 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 10 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association The interaction does not need the presence of the holliday junction