IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of human HSP22 (HSPB8) with other small heat shock proteins. Interaction of human HSP22 (HSPB8) with other small heat shock proteins. J. Biol. Chem. (0021-9258) 2004 Sun X., Fontaine JM., Rest JS., Shelden EA., Welsh MJ., Benndorf R. fig 3a, 3c, 3d, 4a, 4d, 4e, 4f, 5a, 5d, 5e, 5f, 6a, 6b, 6f, 6g, 6h rbenndo@umich.edu chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sun X., Fontaine JM., Rest JS., Shelden EA., Welsh MJ., Benndorf R. fig 3a, 3c, 3d, 4a, 4d, 4e, 4f, 5a, 5d, 5e, 5f, 6a, 6b, 6f, 6g, 6h rbenndo@umich.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 Interaction of human HSP22 (HSPB8) with other small heat shock proteins. Interaction of human HSP22 (HSPB8) with other small heat shock proteins. J. Biol. Chem. (0021-9258) 2004 Sun X., Fontaine JM., Rest JS., Shelden EA., Welsh MJ., Benndorf R. fig 3a, 3c, 3d, 4a, 4d, 4e, 4f, 5a, 5d, 5e, 5f, 6a, 6b, 6f, 6g, 6h rbenndo@umich.edu chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Sun X., Fontaine JM., Rest JS., Shelden EA., Welsh MJ., Benndorf R. fig 3a, 3c, 3d, 4a, 4d, 4e, 4f, 5a, 5d, 5e, 5f, 6a, 6b, 6f, 6g, 6h rbenndo@umich.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 Interaction of human HSP22 (HSPB8) with other small heat shock proteins. Interaction of human HSP22 (HSPB8) with other small heat shock proteins. J. Biol. Chem. (0021-9258) 2004 Sun X., Fontaine JM., Rest JS., Shelden EA., Welsh MJ., Benndorf R. fig 3a, 3c, 3d, 4a, 4d, 4e, 4f, 5a, 5d, 5e, 5f, 6a, 6b, 6f, 6g, 6h rbenndo@umich.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sun X., Fontaine JM., Rest JS., Shelden EA., Welsh MJ., Benndorf R. fig 3a, 3c, 3d, 4a, 4d, 4e, 4f, 5a, 5d, 5e, 5f, 6a, 6b, 6f, 6g, 6h rbenndo@umich.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 Interaction of human HSP22 (HSPB8) with other small heat shock proteins. Interaction of human HSP22 (HSPB8) with other small heat shock proteins. J. Biol. Chem. (0021-9258) 2004 Sun X., Fontaine JM., Rest JS., Shelden EA., Welsh MJ., Benndorf R. fig 3a, 3c, 3d, 4a, 4d, 4e, 4f, 5a, 5d, 5e, 5f, 6a, 6b, 6f, 6g, 6h rbenndo@umich.edu human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink predetermined predetermined participant predetermined Sun X., Fontaine JM., Rest JS., Shelden EA., Welsh MJ., Benndorf R. Cells overexpressing flag-HSP22 were cross-linked with glutaraldehyde and the proteins were analyzed by SDS-PAGE. fig 3a, 3c, 3d, 4a, 4d, 4e, 4f, 5a, 5d, 5e, 5f, 6a, 6b, 6f, 6g, 6h rbenndo@umich.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2004 hspb7_human Heat shock protein beta-7 HSPB7 CVHSP Cardiovascular heat shock protein protein protein human Homo sapiens Human MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI 0A6F47931AE67B3E hspb2_human Heat shock protein beta-2 HSPB2 DMPK-binding protein protein protein human Homo sapiens Human MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP DIP protein Q16082 original sequence version: null 7586DCE8FBD19F6D hspb8_human Heat shock protein beta-8 HSPB8 CRYAC E2IG1 HSP22 PP1629 Alpha-crystallin C chain Small stress protein-like protein HSP22 E2-induced gene 1 protein Protein kinase H11 protein protein human Homo sapiens Human MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT B76058CED52292CB hspb1_human Heat shock protein beta-1 HSPB1 HSP27 HSP28 Heat shock 27 kDa protein Stress-responsive protein 27 Estrogen-regulated 24 kDa protein 28 kDa heat shock protein protein protein human Homo sapiens Human MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK 1B4DC44A6F6606D5 1B4DC44A6F6606D5 hspb8-hspb8-1 3 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association hspb8-hspb8-2 3 7 unspecified role unspecified role bait bait n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 16 14 physical association physical association hspb8-hspb8-3 3 7 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association hspb8-hspb8-4 3 7 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 24 26 physical association physical association hspb7-hspb8-1 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association hspb7-hspb8-2 3 7 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-739394]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 171-171, sequence length 170 [EBI-739394]72-171 physical association physical association hspb7-hspb2-1 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association hspb7-hspb1-1 3 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association hspb7-hspb1-2 3 8 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association hspb8-hspb8-5 1 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hspb7-hspb8-3 1 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hspb7-hspb2-3 1 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hspb7-hspb8-4 2 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept eyfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role fluorescence donor fluorescence donor ecfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction hspb7-hspb1-3 2 8 unspecified role unspecified role fluorescence donor fluorescence donor ecfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept eyfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction hspb7-hspb2-4 2 6 unspecified role unspecified role fluorescence donor fluorescence donor ecfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept eyfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction hsp22-hsp22-1 4 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homodimers and homotetramers were found