IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Vps20p and Vta1p interact with Vps4p and function in multivesicular body sorting and endosomal transport in Saccharomyces cerevisiae. Vps20p and Vta1p interact with Vps4p and function in multivesicular body sorting and endosomal transport in Saccharomyces cerevisiae. J. Cell. Sci. (0021-9533) 2003 Yeo SC., Xu L., Ren J., Boulton VJ., Wagle MD., Liu C., Ren G., Wong P., Zahn R., Sasajala P., Yang H., Piper RC., Munn AL. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid partial dna sequence hybrid partial dna sequence identification by hybridization partial dna sequence hybrid Yeo SC., Xu L., Ren J., Boulton VJ., Wagle MD., Liu C., Ren G., Wong P., Zahn R., Sasajala P., Yang H., Piper RC., Munn AL. J. Cell. Sci. (0021-9533) 2003 Vps20p and Vta1p interact with Vps4p and function in multivesicular body sorting and endosomal transport in Saccharomyces cerevisiae. Vps20p and Vta1p interact with Vps4p and function in multivesicular body sorting and endosomal transport in Saccharomyces cerevisiae. J. Cell. Sci. (0021-9533) 2003 Yeo SC., Xu L., Ren J., Boulton VJ., Wagle MD., Liu C., Ren G., Wong P., Zahn R., Sasajala P., Yang H., Piper RC., Munn AL. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yeo SC., Xu L., Ren J., Boulton VJ., Wagle MD., Liu C., Ren G., Wong P., Zahn R., Sasajala P., Yang H., Piper RC., Munn AL. J. Cell. Sci. (0021-9533) 2003 Vps20p and Vta1p interact with Vps4p and function in multivesicular body sorting and endosomal transport in Saccharomyces cerevisiae. Vps20p and Vta1p interact with Vps4p and function in multivesicular body sorting and endosomal transport in Saccharomyces cerevisiae. J. Cell. Sci. (0021-9533) 2003 Yeo SC., Xu L., Ren J., Boulton VJ., Wagle MD., Liu C., Ren G., Wong P., Zahn R., Sasajala P., Yang H., Piper RC., Munn AL. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yeo SC., Xu L., Ren J., Boulton VJ., Wagle MD., Liu C., Ren G., Wong P., Zahn R., Sasajala P., Yang H., Piper RC., Munn AL. J. Cell. Sci. (0021-9533) 2003 vps4_yeast Vacuolar protein sorting-associated protein 4 VPS4 CSC1 END13 GRD13 DID6 Protein END13 DOA4-independent degradation protein 6 Vacuolar protein-targeting protein 10 VPL4 VPT10 P9705.10 YPR173C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAAKKSPSAGSGSNGGNKKISQEEGEDNGGEDNKKLRGALSSAILSEKPNVKWEDVAGLEGAKEALKEAVILPVKFPHLFKGNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESEKLVKQLFAMARENKPSIIFIDEVDALTGTRGEGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSTEDDETRKLTPCSPGDDGAIEMSWTDIEADELKEPDLTIKDFLKAIKSTRPTVNEDDLLKQEQFTRDFGQEGN E65BCDB19C9510DD E65BCDB19C9510DD vta1_yeast Vacuolar protein sorting-associated protein VTA1 VTA1 YLR181C VPS20-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSLYNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIGSSDEKTLDYADFADDSEEIKDEDVDHQTSDLENNNNDKVEGLAPKDQTTSYEPVDEVPEFIDDADSVNEEEQTVDKNEDAITKDEQQVVKKEVDLTRPSAPSEPAAAEHKSYTKDELTKIMDRASKIEQIQKLAKYAISALNYEDLPTAKDELTKALDLLNSI BB6E6975596C1674 BB6E6975596C1674 vps20_yeast Vacuolar protein sorting-associated protein 20 ASI10 CHM6 VPT20 YM9582.02C YMR077C VPS20 Vacuolar protein-targeting protein 20 Amino acid sensor-independent protein 10 Charged multivesicular body protein 6 ESCRT-III complex subunit VPS20 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGQKSSKVHITKTDRAILEVKRSKDEIHKFTRRTDNLILVEKSQLKDLIRKNPENYKSNMKVRFLLKRIHYQEHLLQQASDQLINLENMVSTLEFKMVEKQFINGLKNGNEILKKLNKEFSNVDELMDDVQDQIAYQNEINETLSRSLVGTSNYEDDLDKELDALESELNPEKMNNAKVANMPSTEGLPSLPQGEQTEQKEREEFATEERSDTKEPLALLS CDC88BC4ADA3D602 CDC88BC4ADA3D602 vps4-vps20 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey short-vps20 Fragment missing the two n-terminal residues binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain physical association physical association vps4-vta1 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey c-terminus Fragment missing the 107 n-terminal residues binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain physical association physical association vps4-vps20-1 2 4 unspecified role unspecified role bait bait n-terminus Fragment 1 to 128 binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey short-vps20 Fragment missing the two n-terminal residues binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain physical association physical association vps4-vps20-2 2 6 unspecified role unspecified role prey prey short-vps20 Fragment missing the two n-terminal residues binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait c-terminus Fragment 351 to 437 binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-491658]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 438-438, sequence length 437 [EBI-491658]352-438 physical association physical association vps4-vta1-1 2 5 unspecified role unspecified role prey prey c-terminus Fragment missing the 107 n-terminal residues binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait c-terminus Fragment 351-437 binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-491665]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 438-438, sequence length 437 [EBI-491665]352-438 physical association physical association vps4-vps20-3 2 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey c-terminus Fragment 42 to 221 binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association vps4-vta1-2 2 5 unspecified role unspecified role prey prey c-terminus Fragment 265 to 330 binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-491677]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 331-331, sequence length 330 [EBI-491677]266-331 4 unspecified role unspecified role bait bait physical association physical association vps4-vps20-4 3 4 unspecified role unspecified role prey prey c-terminal GFP tagged full length vps4 tag tag polyclonal western polyclonal antibody western blot certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role bait bait short-vps20 Fragment missing the two n-terminal residues binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain n-terminal Full length GST tagged VPS20 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association vps4-vps20-5 3 6 unspecified role unspecified role bait bait n-terminal Full length GST tagged VPS20 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey c-terminal 6HIS tagged full length vps4 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag monoclonal western monoclonal antibody western blot certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association vps4-vta1-3 3 5 unspecified role unspecified role bait bait n-terminal GST tagged full length vta1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey c-terminal GFP tagged full length vps4 tag tag polyclonal western polyclonal antibody western blot certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association vps4-vta1-4 3 5 unspecified role unspecified role bait bait n-terminal GST tagged full length vta1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey c-terminal 6HIS tagged full length vps4 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag monoclonal western monoclonal antibody western blot certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association