IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Protein interaction analysis of SCF ubiquitin E3 ligase subunits from Arabidopsis. Protein interaction analysis of SCF ubiquitin E3 ligase subunits from Arabidopsis. Plant J. (0960-7412) 2003 Risseeuw EP., Daskalchuk TE., Banks TW., Liu E., Cotelesage J., Hellmann H., Estelle M., Somers DE., Crosby WL. Source of the arabidopsis cDNA library used in this study was not given in this report. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Risseeuw EP., Daskalchuk TE., Banks TW., Liu E., Cotelesage J., Hellmann H., Estelle M., Somers DE., Crosby WL. There appears to be a discrepency between the results described within the text (page 762) and figure 5 of this report, concerning interaction between F box proteins and Cullin proteins. The data relating to these protein protein interactions was therefore not included in this entry. Source of the arabidopsis cDNA library used in this study was not given in this report. Revisit when contact author resolves Cullin-FBP interaction data A directed yeast two hybrid assay was used in this study. bcrosby@uwindsor.ca Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Plant J. (0960-7412) 2003 Protein interaction analysis of SCF ubiquitin E3 ligase subunits from Arabidopsis. Protein interaction analysis of SCF ubiquitin E3 ligase subunits from Arabidopsis. Plant J. (0960-7412) 2003 Risseeuw EP., Daskalchuk TE., Banks TW., Liu E., Cotelesage J., Hellmann H., Estelle M., Somers DE., Crosby WL. Source of the arabidopsis cDNA library used in this study was not given in this report. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Risseeuw EP., Daskalchuk TE., Banks TW., Liu E., Cotelesage J., Hellmann H., Estelle M., Somers DE., Crosby WL. Source of the arabidopsis cDNA library used in this study was not given in this report. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Plant J. (0960-7412) 2003 ski14_arath F-box protein SKIP14 At3g26000 SKIP14 SKP1-interacting partner 14 MPE11.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALNFSHRPFSSHLSEEPMMIANGNWCSSFDNGRKNTGGDASSVDILDVLPSDPFGMDINNTFTAITGWLEDLEDDYNNQYGRRRRDDIWIGDGNRQQLFAGLSFFWNNAMQFQSSGYSYGSESLFGGAFDGSLFSTCKFPESSGENNGFGGALDGDGSCHGAFISASSVDEVLSHENARNGEVVGSSDRCNNGEEDAYVHPAIGFCLYHLRGKDLLSVSMVCKSLHTTVCDDTLLWKHIHICRPLNEKITEEALLHLTERAQGTMQCLRIVDCCRITDDCLKRVVARNRQVVKIGVPGCTRITIDGILSVLRDLKSAGKLQVKHLQLRGLFGVTKDHYDELIDLLNIDNKVKQTIQKPRFYHRGEACVSCDDDRALDIEMCPKCQNFKLVYDCPAEDCKGKKKGSEECRACSLCIQRCYHCGRCIIDTEYEEMFCLELLCAVCSKPTPKLTL CCD32A1DBA9039C4 q9c5t5_arath ASK10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TRPGQRKVRLTSSDGETFEVERDVIALSTTLNTMMMDLGLDNADAEMDAVPLQNVAGPILRKVLLWCTSHKDDPPSADDDNREKRTDDIPSWDVEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRRTFNIKNDFTPEEEEQIRRENAWCED 29F4F95A5FBC6B4C tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL DIP protein Q570C0 original sequence version: 83 DIP protein Q570C0 original sequence version: 40 DIP protein Q570C0 original sequence version: 86 DIP protein Q570C0 original sequence version: 60 9E19ED5DABF40D07 tlp10_arath Tubby-like F-box protein 10 At1g25280 TULP10 F4F7.13 SKIP26 SKP1-interacting partner 26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSFRGIVQDLRDGFGSLSRRSFDFRLSSLHKGKAQGSSFREYSSSRDLLSPVIVQTSRWANLPPELLFDVIKRLEESESNWPARKHVVACASVCRSWRAMCQEIVLGPEICGKLTFPVSLKQPGPRDAMIQCFIKRDKSKLTFHLFLCLSPALLVENGKFLLSAKRTRRTTRTEYIISMDADNISRSSNSYLGKLRSNFLGTKFLVYDTQPPPNTSSSALITDRTSRSRFHSRRVSPKVPSGSYNIAQITYELNVLGTRGPRRMHCIMNSIPISSLEPGGSVPNQPEKLVPAPYSLDDSFRSNISFSKSSFDHRSLDFSSSRFSEMGISCDDNEEEASFRPLILKNKQPRWHEQLQCWCLNFRGRVTVASVKNFQLVAARQPQPQGTGAAAAPTSAPAHPEQDKVILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE C77BEA9ED18B9D21 ask15_arath SKP1-like protein 15 ASK15 T5M7.16 At3g25650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLTSSDGESFQVEEVVARKLQIVKHLLEDDCVINEIPLQNVTGNILSIVLEYCKKHVDDVVDDDASEEPKKKKPDDEAKQNLDAWDAEFMKNIDMETIFKLILAANYLNVEGLLGLTCQTVADYIKDKTPEEVRELFNIENDFTHEEEEEAIRKENAWAFEADTKHEDPKP 05C92321D745D219 ski22_arath F-box protein SKIP22 SKIP22 At1g23780 F5O8.33 SKP1-interacting partner 22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLRLRHHETRETLKLELADADTLHDLRRRINPTVPSSVHLSLNRKDELITPSPEDTLRSLGLISGDLIYFSLEAGESSNWKLRDSETVASQSESNQTSVHDSIGFAEVDVVPDQAKSNPNTSVEDPEGDISGMEGPEPMDVEQLDMELAAAGSKRLSEPFFLKNILLEKSGDTSELTTLALSVHAVMLESGFVLLNHGSDKFNFSKELLTVSLRYTLPELIKSKDTNTIESVSVKFQNLGPVVVVYGTVGGSSGRVHMNLDKRRFVPVIDLVMDTSTSDEEGSSSIYREVFMFWRMVKDRLVIPLLIGICDKAGLEPPPCLMRLPTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNFVVTEAGDSVNWKARFATFWRQKQLAAASDTFWRQNQLGRRNISTGRSGIRFPRIIGDPPFTWFNGDRMHGSIGIHPGQSARGLGRRTWGQLFTPRCNLGGLN D068CCF15448EFC3 cul1_arath Cullin-1 CUL1 At4g02570 T10P11.26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERKTIDLEQGWDYMQTGITKLKRILEGLNEPAFDSEQYMMLYTTIYNMCTQKPPHDYSQQLYDKYREAFEEYINSTVLPALREKHDEFMLRELFKRWSNHKVMVRWLSRFFYYLDRYFIARRSLPPLNEVGLTCFRDLVYNELHSKVKQAVIALVDKEREGEQIDRALLKNVLDIYVEIGMGQMERYEEDFESFMLQDTSSYYSRKASSWIQEDSCPDYMLKSEECLKKERERVAHYLHSSSEPKLVEKVQHELLVVFASQLLEKEHSGCRALLRDDKVDDLSRMYRLYHKILRGLEPVANIFKQHVTAEGNALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTECFQNHTLFHKALKEAFEIFCNKTVAGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLLFDRSANDDHERSILTKLKQQCGGQFTSKMEGMVTDLTLARENQNSFEDYLGSNPAANPGIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHINGKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKILLKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPLPPVDERKKVVEDVDKDRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYLA DIP protein Q94AH6 original sequence version: 102 DIP protein Q94AH6 original sequence version: 95 45041357DE8DAD8C virf_agrt9 Protein VirF virF protein protein agrt9 Agrobacterium tumefaciens (strain 15955) MRNSSLRDASGSNDAQVPHKTELLNLPDHVLTEVAKRLATNNPVESAENIANFSKSHRFTRDAVRTEPLEKFSSRLKILSRNAKLLSHAVRHAATLPDGEQLSEAQLSQMRSEVATRPVLGVAYTHQDGQPEERLSGNHLDHKINNIPNLVFNVAEPIMFNEISALEVMAEVRPIARSIKTAHDDARAELMSADRPRSTRGL 3B0E33E157C1ADD1 ask8_arath SKP1-like protein 8 At3g21830 ASK8 MSD21.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTKKIMLKSSEGKTFEIEEETARQCQTIAHMIEAECTDNVILVLKMTSEILEMVIEYCNKHHVDAANPCSDDDLEKWDKEFMEKDKSTIFALTNAANFLNNKSLLHLAGQTVADMIKGNTPKQMREFFNIENDLTPEEEAAIRRENKWAFE 56B709C1B7623918 eid1_arath Phytochrome A-associated F-box protein Empfindlicher im dunkelroten Licht protein 1 EID1 At4g02440 T14P8.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAESVFSCIPEDVVFNIFFKLQDDPRNWARLACVCTKFSSIVRNVCCKTQCYSAIPTVISDLLPLPPSAAASASSSTAADSSLTPPGGWASLYKLAVCCPGLFHAGILLENSDFGLERELGPDQNLDPKPTTTDLALNDEEVSKPVGSGLETTSFWSLYDDLYTDTIPAPPPEDSIDDQEEEIETSEIRPGRDLPVRKRRKICRSLGSHLASGGWNLSREQGNKLLASRFRGDCLYICNWPGCIHVEEKRNYMLFRGVFKDFKRSRVWRTINDGNRSKTSGLKCAFCLCDETWDLHSSFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTALPLYT 0E4231CCF243487C afr_arath F-box protein AFR Protein ATTENUATED FAR-RED RESPONSE AFR At2g24540 F25P17.16 SKIP29 SKP1-interacting partner 29 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEQETTSNINTINDQAEEETRTKSQPLISGLPNDIAELCLLRLPYPYHALYRSVSSSWNKTITNPRFLFSKQSLSISSPYLFVFAFNKSTARIQWQSLDLASGRWFVLPPMPNSFTKISSPHALSCASMPRQGKLFVLGGGDVNRSAVVYTALTNRWSCISPMMSPRTYFVSGNVNGKIMAVGGSVGGNGEATTEVESYDPDNDTWTVVKKLPMVLAKYDSAVIGKEMCVTEGWAWPFMFPPMGQVYDSDEGTWREMSGGMKEGWTGVSVVIRDRLFVISEHGDFPMKVYCSDDDTWRYVSGEKLQGEKMRRPFAVTGADDRVFVVASGINVAEGRVSEGQNGDFSVEWRMVSSPKSSIQFSPASCHVLYV 0F48D9747B900634 ask18_arath SKP1-like protein 18 At1g10230 F14N23.11 ASK18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKILLTSSDGESFEIDEAVARKFLIIVHMMEDNCAGEAIPLENVTGDILSKIIEYAKMHVNEPSEEDEDEEAKKNLDSWDAKFMEKLDLETIFKIILAANYLNFEGLLGFASQTVADYIKDKTPEEVREIFNIENDFTPEEEEEIRKENAWTFNE 5DF3C1D971B73981 ado1_arath Adagio protein 1 ADO1 FKL2 Protein ZEITLUPE Clock-associated PAS protein ZTL LOV kelch protein 1 Flavin-binding kelch repeat F-box protein 1-like protein 2 F-box only protein 2b LKP1 ZTL MSF19.2 At5g57360 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEWDSGSDLSADDASSLADDEEGGLFPGGGPIPYPVGNLLHTAPCGFVVTDAVEPDQPIIYVNTVFEMVTGYRAEEVLGGNCRFLQCRGPFAKRRHPLVDSMVVSEIRKCIDEGIEFQGELLNFRKDGSPLMNRLRLTPIYGDDDTITHIIGIQFFIETDIDLGPVLGSSTKEKSIDGIYSALAAGERNVSRGMCGLFQLSDEVVSMKILSRLTPRDVASVSSVCRRLYVLTKNEDLWRRVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAAAWRKLSVGGSVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSDYPEWQHVKVSSPPPGRWGHTLTCVNGSNLVVFGGCGQQGLLNDVFVLNLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSIEKPVWREIPAAWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLKFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGVAPPPRLDHVAVNLPGGRILIFGGSVAGLHSASQLYLLDPTEDKPTWRILNIPGRPPRFAWGHGTCVVGGTRAIVLGGQTGEEWMLSELHELSLASYLT DIP protein Q94BT6 original sequence version: 95 B25192FCBE019093 q7xjl8_arath At2g17030 protein At2g17030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVDWSTLPKDLLDLISKSLESSFDLIQFRSVCSSWRSAAEPKSPLPTHHLPILPDNGGSLFPDSAVGFRLSQRSILLIKPHEPCIESDSFGWLIKVEEDLNVPRKVTLLDPLCDTRNSIPENFPRVLDMSKFKVRELGREFKLHYFNTVGDIVESLYLEKAVVKYLDCDGDYKFVLLTIHVSGKLAVFRSWDRAWTVINDMPSPYDDVMLFDGRFFAVDNNGRTVVVDYSSLKLTLVASPVFGGDKNVLKIILEKHHPNLEKHVYNPKLKKIGDAMTIHGGKPNLTLTLVYPSTFTSRHKALNQMTSSSNSGLRRFLFTPPQRLSQGICYWGAELSNNVSWTYKTKMVVRSKAGAVPLMKHGDRFLSSLSSPALAGDPSAINRHIKKFVAASPKSVALNVLSHLLSDQTSHPHLSFFALSLYSEITEASWFDWNPKLIAELIALLNKQERFDESETLLSTAVSRLKSNERDFTLFLCNLVESNSKQGSIQGFSEASFRLREIIQRSSSVYVKTQAYKSMVSGLCNMDQPHDAERVIEEMRMEKIKPGLFEYKSVLYGYGRLGLFDDMNRVVHRMGTEGHKIDTVCSNMVLSSYGAHDALPQMGSWLQKLKGFNVPFSIRTYNSVLNSCPTIISMLKDLDSCPVSLSELRTFLNEDEALLVHELTQSSVLDEAIEWNAVEGKLDLHGMHLSSSYLILLQWMDETRLRFSEEKCVIPAEIVVVSGSGKHSNVRGESPVKALVKKIMVRTGSPMRIDRKNVGSFIAKGKTFRSVCSSWRSAAGPKRLLWAHNLPFFPSDDKPFLSNVILRVAHQSILLIKPNEPQCEADLFGWIVKVWDNIYVSRKMTLLKPLSSSRNYFPQHLPRIFDMSKFTVRELCREVKLYHPDYYCVPGHTALELELGKTVVKYLNDDKFVLLTILEYGKLAVFRSWDREWTVINDYIPSRCQDLIMFDGRFFAIDYNGRTVVVDYSSFKLTLAANPLIGGGDKKFLIESCGEMFLVDIEFCLNEKPEFTGGFYSYFNETTVSYKFKFFKLVEREKRWVEVEDLGDKMFFLGDDSTFSASTADIIPRCVGTGSFVFFYTHEESLVVMDDRNLGVFDFRSGKTELVNKLPEYAKLFWPPPPWITTSHEVSGFQSLNHPNRVYLHLHLTTSFLPLVSLTYAQISFVSEC E5B3539FE98F79C5 ski28_arath F-box protein SKIP28 SKIP28 At2g01620 MEE11 SKP1-interacting partner 28 Protein MATERNAL EFFECT EMBRYO ARREST 11 T8O11.21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKTELEEEEEEEWRSVHEVLLIVLPYLHSLFELLSMIRVSRSLRDAIRDETALWTKLVIEPPLSSRLTDDILSEFSSKSAGKLKTLILRQCLMVTNKGLRRVVDANPLITKIIVPGCSGLTPEGIMECVESLSKNNHKLETLHINGVNGFTKQHLSALYTYLSSEGTIDLEVCPKCDEVRMIPSCSRESCNQKQRKCRGCWLCIPRCAECAVCLVGSDTESQEAACGNDDVLCLECWLVLPKCRFCNKPYCTNHSSRRHEIAITDAASRPSFECEACYYRAGTNPYEVDYQI 250E7397BF69569A ask14_arath SKP1-like protein 14 At2g03170 ASK14 T18E12.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTEVPLQNVTGKILSIVVEYCKKHVVDEESDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEEIREIFNIENDFTPEEEAAVRKENAWAFE DIP protein O81057 original sequence version: 91 276BB2CB0AF5DE01 ski27_arath F-box protein SKIP27 SKIP27 F18E5.130 At4g21510 SKP1-interacting partner 27 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIHYLHFIGEFCFSSAVKVVEWFSENLFLKRSTMALSKRGFVMTSNARFHGEEEELELGLGSVRFTRGLGRKRILISSCVRESLSRSAVEIPVVSESPPVKSSLKRQRSRITIVSSSSSEKSRLECLPQDLLIRVICGVDHEDLKSLKLVSKSIREASLVAKTLHFAYTTPKKTRAFRNSIDLEEVSDSRHQEDDIEPPNAPRHYRWTKAKRKEQLSSVSAALFT B421706ACCFCD7C3 skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE DIP protein Q39255 original sequence version: 115 DIP protein Q39255 original sequence version: 118 DIP protein Q39255 original sequence version: 108 DIP protein Q39255 original sequence version: 88 DIP protein Q39255 original sequence version: 100 56B84C19FD5ABF17 pp2b1_arath F-box protein PP2-B1 Protein PHLOEM PROTEIN 2-LIKE B1 PP2B1 T16F16.2 At2g02230 SKIP21 SKP1-interacting partner 21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEQIHGGDSNSGGGGGGSSRNDEISVTRASRFDALPEDCISKVISHTSPRDACVVASVSKSVKSAAQSDLVWEMFLPSEYSSLVLQSANHLSKKEIFLSLADNSVLVENGKKSFWVEKASGKKCYMLSAMELTIIWGDSPAYWKWITVPESKFEKVAELRNVCWFEVRGKISCGMLSKGTHYSVYVVFKTANGRSYGFDLVPVEAGVGFVGKVATKKSVYFESGNADSRSATSHYSGISYAMVSRAFRMRRPWMQVQREEEEEVEGERERGMNVVGPKERVDGWSEVELGKFYINNGGCGDDGSDEIEISIMETQNGNWKSGLIIQGIEIRPERSN FB95AEAFCC5807C3 skp1b_arath SKP1-like protein 1B SKP1-like 2 UFO-binding protein 2 ASK2 UIP2 At5g42190 MJC20.30 SKP1B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE DIP protein Q9FHW7 original sequence version: 101 DIP protein Q9FHW7 original sequence version: 104 DIP protein Q9FHW7 original sequence version: 86 9695CC9F57FC935F ask13_arath SKP1-like protein 13 ASK13 At3g60010 F24G16.280 T2O9.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKMVMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANGVPIANVTGVILSKVIEYCKKHVVSDSPTEESKDELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGKKPDEIRALLGIENDFTPEEEEEIRKENQWAFE DIP protein Q9M1X5 original sequence version: 75 FF771FCF3B9844A5 ask19_arath SKP1-like protein 19 At2g03160 ASK19 T18E12.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKKIVLTSSDGESFKVEEVVARKLQIVGHIIEDDCATNKIPIPNVTGEILAKVIEYCKKHVEDDDDVVETHESSTKGDKTVEEAKKKPDDVAVPESTEGDDEAEDKKEKLNEWDAKFMKDFDIKTIFDIILAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIENDFTPEEEEAIRNENAWTFEQDGKQQVPKP 80F8609914DC6C87 ask4_arath SKP1-like protein 4 T20H2.8 At1g20140 ASK4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLTCKAVADQMRGKTPEQMRAHFNIKNDYTPEEEAEVRNENKWAFE DIP protein Q9LNT9 original sequence version: 89 9B0AD6B569A5F932 skip6_arath F-box/kelch-repeat protein SKIP6 SKP1-interacting partner 6 At2g21950 SKIP6 F7D8.27 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAATTSSGDEPPETKSPAQLIPLLSEDVALSCLARVPRCHYPILSLVSKTFRSLPTSPLLYATRALVGATENILYVAIRIPPESGACWFTLLHRTLSNSTNSKMLVPIPSCPSPSLVGSAYVVVDSEIYVIGGSIRDVPSSSVWVLDCRFHTWRRVSNMRVGREFAAAGVIDGKIYVIGGCVVDNWARSINWAEMFDIKTQTWEPVASPGMEVREKWMHASAVMEGKVYAMADRNGVVYEPKEKKWEMPEKRLDLGWRGRACVIENILYCYDYLGKIRGYDPKERIWRELKGVESLPKFLCGATMANRGGKLTVLWEGKAGSGGSRRMEIWCAEIDVGRRGEREIWGKIEWSGTVLTVPNESAIVNCLAATV 9B0089976AC30898 ski31_arath F-box protein SKIP31 At5g45360 SKIP31 MFC19.2 SKP1-interacting partner 31 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSVSDEEDECFARFLESEVSSVEDKEETKEPEAKRQRIEKGETKALEKDEDQKENGNKDKTDAKRIESGVFTNVPTELFRHILKFLSSEDLVSCSLVCKFLNFAAADESLWRRLYCIRWGLTLPSRKLRESAWKKLYIDRDEQDMIELVRTCPSDFKEYYVHMQAAKRSQAPLPSQMVDDRIILDNTVLEQVSLWKKSKGLTDKAVTGHICLGTKCSYHQIDDVFICKETGNVHVCDDNCKEVILSPEGDLMVCTISGVCSDTLLVQTEPDADGCYEEEAELEAEVFTDKSRLARAFELGYNCDDEQELERTLRFC EDE10BCF073E8CF8 ski24_arath F-box protein SKIP24 At1g08710 SKIP24 SKP1-interacting partner 24 F22O13.19 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSANEIPDELWRKILEIGVKSSTFSYKDLCCISISSRRLFRLSCDDSLWDLLLVHDFPNHIVSASSSSESPTKFIYMTRFEREKERKLAAHRRALLRKESEISEWGRRIRELEARLSDEAERLQSSSLQFSDLLKVRQASVALNVWQPEVVRGRQKQMVEQNAVPVEGRLRALEMEMKLCKQQIMGLNRALREVKHRYDIAIKELESMKYHPLRDYKSIRNGDQGSNGKTKKLKTSINYSGDQVSNGKRRKLKTSIDCKFMNISHFSSCSSVTEKFYSYSPKIIHEYIPENLLVL DC3C45148D385E63 ski35_arath Ankyrin repeat protein SKIP35 SKIP35 At3g59910 SKP1-interacting partner 35 F24G16.180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKEGVCDTINLSDQMYPDEPFCSEMKTETIASSQKFEGGEGSKVVFSREAPLIGKDSAGTNSGECCGCSAKKLNFKGDDDLVEKENIEQQKKLNRQERIELGRLFQGAVTSLDWELAERLIQLADPQTLNDLLCVGLDSVWFLSTKPEFQGITGLIKKIICHGAHDFTRATLRTSFLASCVSACQSRTMSLSDTVTVMAQRLHERLQECNGDEILKAEAGAKVQKFTEWALKCIGFHSRCQGAKDRVSQNSAAEIELQLSAFKMFLDLAGNHLSGRDFTEAFDAACFPLTLFSNSFDPGWASGMSATVIQGLLGMLVEGGADNVNQCFLEASRFGSTELVRVLLQIAQRNSLDVDVDLALGFASHYCKIGTMKCLVEEGNAIAFLGPLMRAAERGCMQVVQWFVKRGCRDMELCLALTAATSSCQVEVAAYLLPRVPPPVLTALSIEILKAAGERSGGSLQGVEFLLKSDFLGDSTATYSVADSIARSSEDESVPSDLKSFLQEHWSESAFEKGMRESHDDFMNFMRVLKKGESAISLRDLPAPLRVAIAYMPLYRECMKADGRLLSQRLRGQLVEAVRQLQGCAVAVVEVSQTRNLMAVLEHHLTAIFD 20117DA54E6B4DC2 ski30_arath F-box/kelch-repeat protein SKIP30 SKIP30 At3g63220 F16M2.70 SKP1-interacting partner 30 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCYRQETMSGLLDGIPEAVALRCLAHVPLHLHPNLELVSRSWRAAIRSHELFRVRKELRSSEHLLCVCAFDPENIWQVYSPNCDRWLTLPLLPSRIRHLAHFGAVTTAGMLFVLGGGSDAVSPVTGDHDGTFATDQVWSYDFVQRQWTPRASMLVPRAMFACCVLQGKIVVAGGFTTCRKSISGAEMYDPENDVWTSIPDLHQTHNSACSGLVVNGKVHVLHKGLSTVQVLESVKLGWDVKDYGWPQGPMVVVEDVLYVMSHGLVFKQEGDTWKMVASASEFKRRIGMAMTSLSDEVLIVGGVIGPDRLNWDIKPLSDVDALTVGNDRPAWRSVAPMTRCRGTILGCTQLTI A3CE224DADBAF66C skip1_arath F-box protein SKIP1 SKP1-interacting partner 1 SKIP1 MTI20.16 At5g57900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEDGSDWGGLAPEILINIISRLTIQELWTGPMFVQKSWLTVCRDPYLWSIFDLEPWFDSYPESTHLWSPEFEQKVDLMLRSVVDWSEGGLTKIRVRHCSDHALSYAADRCPNLQVLAIRSSPNVTDASMTKIAFRCRSLKELDISYCHEISHDTLVMIGRNCPNLRILKRNLMDWSSRHIGSVPTEYLDACPQDGDTEADAIGKHMINLEHLEIQFSRLSVKGLASICEGCPKLEYLDLFGCVHLSSRDITSNVSRLKWLKEVKKPDVYVPRSGDVAQTERYGHWRLYDERFDIQAMRI F629B3595DCF5EC5 ski17_arath F-box protein SKIP17 SKIP17 T5J8.4 At4g02740 SKP1-interacting partner 17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPPTQSHNSVRTVPGSNHSHTDLIISSFLSFPDSSPISISNSFDRVLDRALASASADESVQDRLVDRTLELASLLLDSTRRCFRKRASVHNSNSWSLPPELTIKVFSMLDTKSMMQAAVCCTMFNKCAMDRLCYSHIDLTTSARYADKGVVSTMINRAGKELRSLKLGRVVRTAGSDSAAPLLSGSCLSPLAYNHGFLGSRLRSLRLYNLRPIKYRSLCDALSVCPNITDLRIVGLYNLTEELFNSLTKKCRLIEHLFLETYGYPRTLESKAGSSLVEFVTNCPNLTSLTLIRFGLTDDWARNLAESCRKLKYLNLSRSPTIKGRFLRELGLSCKENLLKTLILRSCPKLQEKEVLEFCNSLLTGNFKSIRQIDVSSNSGLASSDRGKRCNKPNFPLERLKEERSDVTFVADFPSTSSGKRYGVCDEEELRLIEMMEAEDDEVDEEDDSDDDTDDVSDEDESENDDDMGMGFDVDYLL D20CD4CEB7E6346A ufo_arath Protein UNUSUAL FLORAL ORGANS F-box only protein 1 UFO At1g30950 F17F8.16 FBX1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSTVFINNPSLTLPFSYTFTSSSNSSTTTSTTTDSSSGQWMDGRIWSKLPPPLLDRVIAFLPPPAFFRTRCVCKRFYSLLFSNTFLETYLQLLPLRHNCFLFFKHKTLKSYIYKRGGTNDDDSNKAEGFLFDPNEIRWYRLSFAYIPSGFYPSGSSGGLVSWVSEEAGLKTILLCNPLVGSVSQLPPISRPRLFPSIGLSVTPTSIDVTVAGDDLISPYAVKNLSSESFHVDAGGFFSLWAMTSSLPRLCSLESGKMVYVQGKFYCMNYSPFSVLSYEVTGNRWIKIQAPMRRFLRSPSLLESKGRLILVAAVEKSKLNVPKSLRLWSLQQDNATWVEIERMPQPLYTQFAAEEGGKGFECVGNQEFVMIVLRGTSLQLLFDIVRKSWLWVPPCPYSGSGGGSSGGGSDGEVLQGFAYDPVLTTPVVSLLDQLTLPFPGVC 6E5C38B0F92AE8B7 ask11_arath SKP1-like protein 11 ASK11 At4g34210 F10M10.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKHHVDEANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE DIP protein O49484 original sequence version: 96 95D23CC17C1523B0 fbw2_arath F-box protein FBW2 FBW2 T3H13.1 At4g08980 SKIP18 SKP1-interacting partner 18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEDCEFRHWDELIPDALGLIFSHLPLQEVLTVVPRVCKAWNRAVTGPYCWQEIDIELWSNRFHQSDHLDRMLEMLIPRSAGSLRKLSVTGLRNDSIFSFIAQHAGSLKTLKVPRSGLTNSGVVNVAEKLSSLTFLDLSYCCKIGPEAIQAIGKHCKSLREFCRNMHPLDVASVVSHDDEAYAIANTMPKLKRLEIAYHRVSTEGVLKILSCCVFLEFLELRGCWDVQLDNKFFKEKFPDMKVLGPRVIGFYDMINDWEDCCSDYFSDGSDYLAWEFFEDGVMGEFYEDEFEHGWDDNFYAENAVLDMEPHIWPPSP FB409A1EA4DAB4F2 ski19_arath F-box protein SKIP19 SKIP19 At4g05460 C6L9.140 FBL20 SKP1-interacting partner 19 F-box/LRR-repeat protein 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSPPAAMEVGESTNWTELPPELTSAILHRLGAIEILENAQKVCRSWRRVCKDPSMWRKIDMHNLGDLDDMDYNLEIMCRHAVDRSQGGLVDIGIWYFGTVDLLNYIAHRSSNLRSLRLIRCSQITDDGFVEAVVKLPLEELELSYCSFSVESLRVVGQCCLNMKTLKLNKHPQKENDDDALAIAETMPKLRHLQLCGNGLSDTGLNAILDNCSNLEHLDLRRCFNVNLVGDLQKRCFESVKVVRHPNDSIHDIDIGSSEDEDPYDFSDIDLMSGDDDFEGYYDFSGASDFSDYDQFDF 20FA8939903BD6C3 p2a14_arath F-box protein PP2-A14 Protein PHLOEM PROTEIN 2-LIKE A14 At5g52120 PP2A14 MSG15.23 SKIP13 SKP1-interacting partner 13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGAASSSIVRSEPFAGKLCGLEDVPENCITAMFMYMEPPEICLLARVNKSFHRASRSDAVWEDKLPSNYKFLVRRILEDQQQVGVKDKLIYRKKEIYARLCRPNLFDTGTKEAWLDKRSGKVFLAISPKAMKITGIDDRRYWEHISSDESRFGSITYLRQIWWLEAVGKIRFEFAPGKYSLLFKIQLGKPIRKCGRKTCSLDQVHGWDIKPVRFQLSTSDGQCAMSERHLDESGRWVYHHAGDFVVENQNSPVWVKFSMLQIDCTHTKGGLCLDCVIICPFEYRGKYKYSD BEB684A7A28A6CF3 ski34_arath Protein SKIP34 SKIP34 SKP1-interacting partner 34 K19O4 At5g65495 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCYGHNQSLSSRSSLRRRSHDGEDDSVVDDLRDRLAETEARLRRARAREAELSRRLEHMKRFVSVMEIIETFLERRFQEQKDRIARLFSPVSTK 2BA0F1998B97AA22 o81622_arath F8M12.7 AT4g10930 F25I24.140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METQPDTSLMETRKSLDISEKTNSGCSVEAVYSGNFSVTVADDGETALVVSIVKGDESHMGPSDTNPLPVQAKMDGDPDSSHLKILCREENTEQVAVKSELNQSLPHDISSRLSSDSDQPFFAADIENRAETKPEIYESLNELKLEEEEELTTVHHESRSPSNNTTVDIFSIVKGTGRRKNLMRSNPTDKSSEAENAAGLRVKKIKRTPEDEKESMVLVEKLRKEIREAVRNKSMEDIRENQFDPKLLAAFRAAVAGPKTGEAPRRSSALAVKAKKLMLQKGKVRENLTKKIYADLNGKRKSAWHRDCEVEFWKHRCIQGRKPEKIETLKSVLSLLKNKPADTKTNFSSETPQASNPILSRLYLADTSVFPRNDNLKPLLAPKEMGNSQNNGKPTEASKTLPKISAAKGSSVKAAGSKLNSGNKQSDGQPNLTSSNSKEMVENPDDLKKDKRKWALQVLARKKALAGNNSTQDKEGSPELKGNYPLLVSTELAVADAINIEKAIADKSSSKVVYLNLCSQEILHHSESKTMDNAVEPNSSSPMADSESERISSKDSDNPAVLEALRAAGLADSPPNSPTRSVEVLPEKGDSSLDKTRETGPYNVFDMDSVPDTDIFGDFEYELDEEDYFGATMAKKASVMQPDESLTKVKVVLSTVQPGKSLNPSEVVEDEETTTENLNETTNGKEDGKSFVPMELVPEAEGEGEGEGEGEGEGEGGGEILSVAECEELYGPGTEKLVERPLIEGFAENGVKAKAPDSECESNTQREFIASNFEITCIQEKKLPRSIQKCKPSEKPSKEEKGKADGFGNSITKKVEAYIKEHIRPLCKSGVINVEQYRWAVTKTTEKVMKYHSKAKSANFLIKEGDKIKKLAEQYVETASSGAHHKDKCKRRKPPLNPKYVTFQAPSSVGFFCSSDSCLQSFFYVSSNFFSFSPRNQSLLFFIIAVPIAIVFFLSRSVPRTRKLDNKPMPSTPLANGGTPPMGGGERTTVTTSTVADDKPGVSMMEQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKVIRFTNHSFVLALCIGNSEMILG BDD8A727287370EA fbx6_arath F-box only protein 6 At1g27340 FBX6 F17L21.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEELAMLRQLIGQLQELLHNGSPPPPSSSSSLSSSSPSFLVLHHPQYQNGWCLPCIEDTSADDCCDIVMAGGKRPGIFKMLETVKPPVKRTRKERTQGKSCTEVDEISGNMDQEIWQEFPQDLFEDVVSRLPMATFFQFRAVCRKWNALIDSDSFSRCFTELPQTIPWFYTITHENVNSGQVYDPSLKKWHHPIIPALPKKSIVLPMASAGGLVCFLDIGHRNFYVSNPLTKSFRELPARSFKVWSRVAVGMTLNGNSTSHGYKVLWVGCEGEYEVYDSLSNVWTKRGTIPSNIKLPVLLNFKSQPVAIHSTLYFMLTDPEGILSYDMVSGKWKQFIIPGPPDLSDHTLAACGERLMLVGLLTKNAATCVCIWELQKMTLLWKEVDRMPNIWCLEFYGKHIRMNCLGNKGCLILLSLRSRQMNRLITYNAVTREWTKVPGCTVPRGRKRLWIACGTAFHPSPTARA 7C16A78A3B026F34 ask12_arath SKP1-like protein 12 ASK12 T4L20.50 At4g34470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKYHVDEANPISEEDLNKWDEKFMDLEQSTIFELILAANYLNIKSLFDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE 0F694CC439552EDD ask7_arath SKP1-like protein 7 At3g21840 ASK7 MSD21.21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTKKIMLKSSDGKMFEIEEETARQCQTIAHMIEAECTDNVIPVSNVTSEILEMVIEYCNKHHVDAANPCSDEDLKKWDKEFMEKDQYTIFHLMNAAYDLHIKSLLALAYQTVADMVNDNKWAFE 92FBD538A99CB3A8 ski15_arath SKP1-interacting partner 15 SKIP15 F22K20.2 At1g76920 FBX3 F-box only protein 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESSPVNCLPPDSLHQIFSSLPIRDIMICRSVCKFFNQLLTSQCFIEIISTRPPLNLLALRPPHHHHSHRHSGNGHATNIRPYIHVYDPEQNQWFRFNLDFLPFRSPQPVASSSGLIYLWGDSIDLAESSKSLVACNPLTRQFKVLPQLGSAWSRHGTVLVDSVNRVMVLTELAALYYSGTVVANQWLKFSSNLPSKPRSPVLMSSSVFALCDVGSPWRSQWKLFSCKLTNLTITHTNWVCLEKHEWGDIFDIIKRPRLLRGNGDSKLLMIGGLKSTFSLNPACSTILILRLDLESLEWEEAGRMPLEMYRGFQESSKFKVFGGGDRVYFSAKRMGKLAMWDCWQGWRWIEGVPGYADGLCRGFVFDAKLTLMP 1D8584587C616173 ask17_arath SKP1-like protein 17 At2g20160 ASK17 MEO Protein MEIDOS T2G17.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKKIVLTSSDDECFEIDEAVARKMQMVAHMIDDDCADKAIRLQNVTGKILAIIIEYCKKHVDDVEAKNEFVTWDAEFVKNIDMDTLFKLLDAADYLIVIGLKNLIAQAIADYTADKTVNEIRELFNIENDYTPEEEEELRKKNEWAFN A8B9E489CF9546DB skp1_yeast Suppressor of kinetochore protein 1 SKP1 CBF3D YDR328C D9798.14 Centromere DNA-binding protein complex CBF3 subunit D E3 ubiquitin ligase complex SCF subunit SKP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 746DDE6470A69432 746DDE6470A69432 p2a11_arath F-box protein PP2-A11 Protein PHLOEM PROTEIN 2-LIKE A11 PP2A11 At1g63090 F16M19.16 SKIP10 SKP1-interacting partner 10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSGFSLFQKNLSSCYGDRDLLQPGLGDLPESCVALILQNLDPVEICRFSKLNTAFHGASWADFVWESKLPPDYKLILEKILGSFPDNLRKRDIFTFLSRVNSFDEGNKKAWVDKRTGGLCLCTSAKGLSITGIDDRRYWSHIPSDDSRFASVAYVQQIWWFQVDGEIDFPFPAGTYSVYFRLQLGKPGKRFGWKVVDTEQVHGWNIKPVRFQLSTEDGQHSSSQCMLTEAGNWSHYHAGDFVVGKSKSSSTKIKFSMTQIDCTHTKGGLCVDSVVVYPSSCKDRLMQI 48E6D138DF703D55 ski11_arath F-box/kelch-repeat protein SKIP11 At2g02870 SKIP11 T17M13.4 SKP1-interacting partner 11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLEDRSPDSCLSTRVFSSSRLSESNWSNSYMYPEDDDKLLGNGKRALEVVGEVRQTKSLKLMGFSIIYDSDSSDYSLSGGEEQADAAIGDGSSSRQEQEQQSDFNDNGGDSSDSHSLINEIGRDNSIDCLIRCSRSDYGSIASLNRNFRSLVKSGEIYRLRRQNGFVEHWVYFSCQLLEWVAFDPVERRWMQLPTMPSSVTFMCADKESLAVGTDLLVLGKDDFSSHVIYRYSLLTNSWSSGMKMNSPRCLFGSASLGEIAIFAGGCDSQGKILDFAEMYNSELQTWITLPRMNKPRKMCSGVFMDGKFYVIGGIGGADSKGLTCGEEYDLETKKWTQIPDLSPPRSRADQADMSPAAEAPPLVAVVNNQLYAADHADMEVRKYDKENKKWLTVGRLPERAGSVNGWGLAFRACGERLIVIGGPKCSGGGFIELNSWIPSDGGPPQWTLLDRKHSPTFVYNCAVMGC 17229589475E13C2 ibr5_arath Protein-tyrosine-phosphatase IBR5 IBR5 SKIP33 Protein INDOLE-3-BUTYRIC ACID RESPONSE 5 SKP1-interacting partner 33 T1O3.4 At2g04550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRKRERENPCSICGHYHKYEEGEVCGVCGHCMPVSSDTVAPQQVHVSAFPSEILPEFLYLGSYDNASRSELLKTQGISRVLNTVPMCQNLYRNSFTYHGLDNEKVLQFDDAIKFLDQCEKDKARVLVHCMSGKSRSPAVVVAYLMKRKGWRLAESHQWVKQRRPSTDISPEFYQQLQEFEQGIFGSEMMSAMNINDAPTFGFGFPKIDNQAQAPVFNNAPTSSIFSSPASSIPPQEFTFGATPPKPTTGGDIAMDGS 68CFA8A26DC933DF ask9_arath SKP1-like protein 9 At3g21850 ASK9 MSD21.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTKKIILKSSDGHSFEVEEEAARQCQIIIAHMSENDCTDNGIPLPNVTGKILAMVIEYCNKHHVDAANPCSDDDLKKWDKEFMEKDTSTIFDLIKAANYLNIKSLFDLACQTVAEIIKGNTPEQIREFFNIENDLTPEEEAAIRRENKWAFE 7F5965319CFAF4F9 ski16_arath F-box protein SKIP16 T21E18.16 At1g06110 SKIP16 SKP1-interacting partner 16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGLEDAGDLVLHIVLSKIGPENTARVACVSKRLKVSASEESLWSIFCSNDLNISTPLDPHGDPAPSFKRAYQLWRESFRMYPWNLVKRVRLCWDNLKQWLTLNFPEAKATLRKGVTEDDLQEFETSLKVKLPLPTRLLYRFVDGQELSSPNGLDGSLGLIGGYSAYSHDVNVYLLPLKEVMRETKESFMRDLGFSSRLDLIVMAASVVASLKIFLLDCTTGQLFTGTSNRQLLPCVPDALVRSVHDTNGDQQQDAMLLWLEEHGRRLQTGTINVRQQNNVKSISLFPEIPPLCSVSVTNGVQVRASSVFIPEISNLRDQPPAYWYAYSIRMSLMPEGCILNGTHHSSCQLYWRHWVIRADNEVIDNVNGEAVIGKYPLLQAGEEEFVYESCSSFPTTAGSIDGSFTFVPGSLRDPKGSQFEVKVVEFPLELPDYIF 2FF2D4AAC5478259 ski25_arath F-box/kelch-repeat protein SKIP25 SKIP25 At1g31350 T19E23.14 SKP1-interacting partner 25 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKKLKRRESMSTTAAESPPAKRRRTVTGNENSALIEGLPDHISEICLSLVHRPSLLSAVCTRWRRLLYSPEFPSFPSLYALFVDSTSDTGRVNPSVRFMCFNPVSSKWYPLPPPPPDPPLHRILYRHPSFISFNLPIQCVSAAGKLILIAGSNQQLSPAISHPLIFDPISSSWSSGPRIGSPRRWCATGACDGAIYIASGISSQFSSTVAKSVEKLDLTEQNRNNHRFNWEKLRDMRDLRFSREAIDAVGYRRKLLMVNVKGDAVKEGAIYDVVKDDWEPMPEEMLVGWRGPVAAMEEEILYSVDERRGTVRKYDDEKREWREVVVVEGGEEMLKGATQVTADSGKLCVVTGDGKIVVVDVAAEPAKIWNVEIPDGLEPVSVHVLPRMSQPNFC 5183FB874F538770 ski32_arath F-box protein 7 SKIP32 At1g21760 F8K7.20 FBP7 SKP1-interacting partner 32 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSDALTIPSELESALRLRTVQYFITKRPWLDLYGVHVRPVPPFGSTSRKPHFDPALIHRCLPDELLFEVFARMMPYDLGRASCVCRKWRYTVRNPMFWRNACLKAWQTAGVIENYKILQSKYDGSWRKMWLLRSRVRTDGLYVSRNTYIRAGIAEWKITNPVHIVCYYRYIRFYPSGRFLYKNSSQKLKDVAKYMNFKASKSENLYKGTYTLSMSDDKIEAAVLYPGTRPTVLRIRLRLRGTAIGANNRMDLLSLVTSGVNDEEISSTEEDILGLVEGWEDDETHNPDIPAVSHKRGMTAFVFVPFEEVDESVLNLPPEKMDYYVTG 4A6CD30291D78908 ski20_arath F-box/kelch-repeat protein SKIP20 SKIP20 At3g59940 F24G16.210 SKP1-interacting partner 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGVSKKKSGEIRGDLIPGLPEELAIECLVRVPFQFHSSIKSVCRSWKCVISSRSFIKERIGFGKAESLLCLVQPLTSPPSPAMMEGGEMSQKKKEEEEGESQMTQQLLQPRITGTPLYGLSVYNATLDTWHRVAIPERIPLFCECVAIQDAGKVLLIGGWDPETLQPVRDVFVLDFFAGEGSGRRFRRGRPMSAARSFFACASVGSTKVYVAGGHDDQKNALRSAEVYDVEKDEWSMLPPMTEGRDECHGFSMATDPGFCVLSGYGTETQGQFRSDGEIYDPITNSWSTIENVWPFPDLSPRGRTAAAAAEFPGDFRGCRLWCFIDSERQSQPHWEVEDDSMKWKVIMDTIRLPVTTMTSVFAGSLSGQAVAMIGGGGEESGTMMVKTTAEKNGGKWSHVNTPSGFSSLPFSCSSIYV 1EA069B038A11323 ask3_arath SKP1-like protein 3 ASK3 At2g25700 F3N11.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETKKMIILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSTENHELKTWDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVADQMRGKTPAQMREHFNIKNDYTPEEEAEVRNENRWAFE 8F7C7796CE5CEB4F p2b11_arath F-box protein PP2-B11 Protein PHLOEM PROTEIN 2-LIKE B11 PP2B11 F18B13.19 At1g80110 SKIP12 SKP1-interacting partner 12 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNNLPEDCIAKILSLTTPLDVCRLSAVSSIFRSAAGSDDVWNHFLPADFPAGFAAPAGLPTRKQLFFSLVDNPLLINGTLLSFSLERKSGNKCYMMAARALNIVWGHEQRYWHWISLPNTRFGEVAELIMVWWLEITGKINITLLSDDTLYAAYFVFKWNHSPYGFRQPVETSLVLADTESTDNVVQPSMISLMQDSGGEEGQSPVLRRDGWYEVELGQFFKRRGDLGEIEMSLKETKGPYEKKGLIVYGIEIRPVP 3DC1A064C2445CB9 q8jzk2_9zzzz SKL1 protein protein uni unidentified MADSTAAQDAPRQEEDARKVNLVSMDGDSFEVSRSVASMSELVKTLISDEQEDDEVQEIPLPNVKSTVLSKVIEFCSHHHNNPMREIEKPLKSSDMHDVVSDWDANFVDIEQDILFELILAANYMDIKSLLDLACAKVASMIKGKTPQEIRETFNIVNDFTPEEESQIREENKWCEEA 9831DB728853C04A p2a13_arath F-box protein PP2-A13 Protein PHLOEM PROTEIN 2-LIKE A13 PP2A13 At3g61060 T27I15.150 SKIP9 SKP1-interacting partner 9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGANISGGSPEFDRNDDVYSRKLRLVDLPENCVALIMTRLDPPEICRLARLNRMFRRASSADFIWESKLPANYRVIAHKVFDEITLTKLIKKDLYAKLSQPNLFDDGTKELWIDKNTGRLCLSISSKALRITGIDDRRYWSHIPTDESRFQSAAYVQQIWWFEVGGEFEIQFPSGTYSLFFRIQLGKTSKRLGRRICNSEHIHGWDIKPVRFQLATSDNQQAVSLCYLNNNPGSWSHYHVGDFKVTNPDVSTGIKFSMTQIDCTHTKGGLCIDSVLILPKECAKEVIGSQ DCC145BB0D652EC9 ask1-eid1 2 20 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association ask1-skip1 2 20 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey physical association physical association ask1-skip6 2 26 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip8 2 20 unspecified role unspecified role bait bait 39 unspecified role unspecified role prey prey physical association physical association ask1-skip9 2 20 unspecified role unspecified role bait bait 57 unspecified role unspecified role prey prey physical association physical association ask1-skip10 2 46 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip11 2 20 unspecified role unspecified role bait bait 47 unspecified role unspecified role prey prey physical association physical association ask1-skip12 2 55 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip13 2 37 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip14 2 20 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association ask1-skip20 2 20 unspecified role unspecified role bait bait 53 unspecified role unspecified role prey prey physical association physical association ask1-skip21 2 21 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip22 2 8 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip23 2 16 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip24 2 20 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey physical association physical association ask1-skip25 2 51 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip26 2 6 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip27 2 20 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association ask1-skip28 2 20 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association ask1-skip29 2 13 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip30 2 20 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey physical association physical association ask1-skip31 2 20 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey physical association physical association ask1-skip32 2 52 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip33 2 20 unspecified role unspecified role bait bait 48 unspecified role unspecified role prey prey physical association physical association ask1-skip34 2 20 unspecified role unspecified role bait bait 38 unspecified role unspecified role prey prey physical association physical association ask1-skip35 2 20 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey physical association physical association ask2-eid1 2 12 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip1 2 22 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey physical association physical association ask2-skip6 2 26 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip8 2 22 unspecified role unspecified role bait bait 39 unspecified role unspecified role prey prey physical association physical association ask2-skip9 2 57 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip10 2 46 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip11 2 47 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip12 2 55 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip13 2 22 unspecified role unspecified role bait bait 37 unspecified role unspecified role prey prey physical association physical association ask2-skip14 2 22 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association ask2-skip19 2 22 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey physical association physical association ask2-skip18 2 35 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip17 2 32 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip16 2 22 unspecified role unspecified role bait bait 50 unspecified role unspecified role prey prey physical association physical association ask2-skip15 2 43 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip20-1 2 53 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip21 2 22 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association ask2-skip22 2 22 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association ask2-skip23 2 16 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip24 2 28 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip25 2 51 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip26 2 22 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association ask2-skip27 2 22 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association ask2-skip28 2 17 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip29 2 22 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association ask2-skip30 2 30 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip31 2 22 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey physical association physical association ask2-skip32 2 22 unspecified role unspecified role bait bait 52 unspecified role unspecified role prey prey physical association physical association ask2-skip33 2 48 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip35 2 29 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association cul1-skip28 2 9 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association cul1-skip19 2 9 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey physical association physical association cul1-skip18 2 9 unspecified role unspecified role bait bait 35 unspecified role unspecified role prey prey physical association physical association cul1-skip14 2 3 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association ask1-skip13-1 1 20 unspecified role unspecified role bait bait 37 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ask1-skip1-1 1 20 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey physical association physical association ask1-skip14-1 1 20 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ask1-skip28-1 1 20 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association ask1-ztl 1 15 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ztl-ask1-5 1 15 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip19 1 36 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role bait bait physical association physical association tir1-ask1-3 1 20 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association ask1-skip9-1 1 20 unspecified role unspecified role bait bait 57 unspecified role unspecified role prey prey physical association physical association ufo-ask1-1 1 33 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association ask1-ufo 1 33 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask1-skip15-1 1 43 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association skip15-ask1 1 43 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association ask1-q9fzk1 1 40 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association q9fzk1-ask1 1 40 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association ask1-skip17 1 32 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role bait bait physical association physical association skip17-ask1 1 32 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey physical association physical association virf-ask1-1 1 20 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association ask1-virf 1 20 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association ask2-ztl-1 1 15 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ztl-ask2 1 22 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association ask2-skip9-1 1 57 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask12-skip13 1 22 unspecified role unspecified role bait bait 37 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association tir1-ask2-3 1 5 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association ask1-skip18 1 35 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association ask2-skip18-1 1 22 unspecified role unspecified role bait bait 35 unspecified role unspecified role prey prey physical association physical association ask12-skip1 1 22 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey physical association physical association ask2-skip19-1 1 22 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ufo-ask2-1 1 22 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait physical association physical association ask2-ufo 1 33 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip15-1 1 43 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association skip15-ask2 1 43 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association ask2-q9fzk1-1 1 40 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait physical association physical association ask2-skip17-1 1 22 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association skip17-ask2 1 22 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ask2-skip14-1 1 22 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ask2-skip28-1 1 22 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association ask2-virf 1 22 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association virf-ask2 1 22 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association ask11-ztl-1 1 34 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association ztl-ask11 1 15 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey physical association physical association ask11-skip9-2 1 57 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait physical association physical association ask11-skip13 1 37 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 34 unspecified role unspecified role bait bait physical association physical association tir1-ask11 1 34 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association ask11-tir1 1 34 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association ask11-skip18 1 35 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait physical association physical association ask11-skip1 1 34 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey physical association physical association ask11-skip19 1 34 unspecified role unspecified role bait bait 36 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ufo-ask11-1 1 34 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait physical association physical association ask11-ufo 1 33 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait physical association physical association ask11-skip15 1 43 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait physical association physical association skip15-ask11 1 34 unspecified role unspecified role prey prey 43 unspecified role unspecified role bait bait physical association physical association ask11-q9fzk1 1 34 unspecified role unspecified role bait bait 40 unspecified role unspecified role prey prey physical association physical association q9fzk1-ask11 1 40 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey physical association physical association ask11-skip17 1 34 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association skip17-ask11 1 32 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 34 unspecified role unspecified role prey prey physical association physical association ask11-skip14 1 34 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ask11-skip28 1 17 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait physical association physical association ask11-virf-1 1 34 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association virf-ask11 1 10 unspecified role unspecified role bait bait 34 unspecified role unspecified role prey prey physical association physical association ztl-ask12 1 41 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association ufo-ask12 1 33 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey physical association physical association skip15-ask12 1 43 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey physical association physical association ask12-q9fzk1 1 41 unspecified role unspecified role bait bait 40 unspecified role unspecified role prey prey physical association physical association skip17-ask12 1 41 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association virf-ask12 1 10 unspecified role unspecified role bait bait 41 unspecified role unspecified role prey prey physical association physical association ask4-skip18 1 35 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait physical association physical association ask4-skip15 1 43 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait physical association physical association skip15-ask4 1 43 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey physical association physical association ask4-skip17 1 25 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association skip17-ask4 1 32 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 25 unspecified role unspecified role prey prey physical association physical association ask4-skip14 1 25 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ask4-skip28 1 25 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association ztl-ask3 1 54 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association skip14-ask3 1 3 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 54 unspecified role unspecified role prey prey physical association physical association ztl-ask9 1 49 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association ask9-skip13 1 37 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 49 unspecified role unspecified role bait bait physical association physical association ask9-tir1 1 5 unspecified role unspecified role prey prey 49 unspecified role unspecified role bait bait physical association physical association ask9-skip15 1 43 unspecified role unspecified role prey prey 49 unspecified role unspecified role bait bait physical association physical association skip15-ask9 1 49 unspecified role unspecified role prey prey 43 unspecified role unspecified role bait bait physical association physical association ask9-q9fzk1 1 40 unspecified role unspecified role prey prey 49 unspecified role unspecified role bait bait physical association physical association skip17-ask9 1 49 unspecified role unspecified role prey prey 32 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ztl-ask7 1 15 unspecified role unspecified role bait bait 42 unspecified role unspecified role prey prey physical association physical association ztl-ask8 1 15 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association ztl-ask19 1 15 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey physical association physical association ask19-skip13 1 24 unspecified role unspecified role bait bait 37 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association ask19-skip18 1 35 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait physical association physical association ufo-ask19 1 24 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait physical association physical association skip15-ask19 1 43 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey physical association physical association q9fzk1-ask19 1 24 unspecified role unspecified role prey prey 40 unspecified role unspecified role bait bait physical association physical association skip17-ask19 1 32 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role prey prey physical association physical association ask14-skip13 1 37 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role bait bait physical association physical association ask14-ufo 1 33 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association ask14-skip15 1 18 unspecified role unspecified role bait bait 43 unspecified role unspecified role prey prey physical association physical association ask14-q9fzk1 1 40 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association ask8-virf 1 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association ask14-skip14 1 3 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role bait bait physical association physical association ask14-skip28 1 17 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association skl1-q9lsx9 1 49 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association skl1-lkp1 1 15 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association skl1-f24g16_280 1 23 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association skl1-at1g10230 1 14 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association skl1-at2g03160 1 24 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association skl1-q9li78 1 7 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association skl1-at2g20160 1 44 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association skl1-at2g03170 1 18 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association skl1-at2g01620 1 17 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association skl1-virf 1 10 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association lkp1-skl1 1 56 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association ufo-skl1 1 56 unspecified role unspecified role prey prey 33 unspecified role unspecified role bait bait physical association physical association q9li78-skl1 1 7 unspecified role unspecified role bait bait 56 unspecified role unspecified role prey prey physical association physical association at2g20160-skl1 1 44 unspecified role unspecified role bait bait 56 unspecified role unspecified role prey prey physical association physical association ask10-q9lsx9 1 49 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ask10-lkp1 1 15 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ask10-f24g16_280 1 23 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ask10-at1g10230 1 14 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ask10-at2g03160 1 24 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ask10-q9li78 1 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ask10-at2g20160 1 44 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ask10-at2g03170 1 18 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ask10-at2g01620 1 17 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association ask10-virf 1 10 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association cbf3d-f24g16_280 1 23 unspecified role unspecified role prey prey 45 unspecified role unspecified role bait bait physical association physical association cbf3d-at2g03160 1 24 unspecified role unspecified role prey prey 45 unspecified role unspecified role bait bait physical association physical association cbf3d-at1g10230 1 14 unspecified role unspecified role prey prey 45 unspecified role unspecified role bait bait physical association physical association cbf3d-q9li78 1 7 unspecified role unspecified role prey prey 45 unspecified role unspecified role bait bait physical association physical association cbf3d-at2g03170 1 18 unspecified role unspecified role prey prey 45 unspecified role unspecified role bait bait physical association physical association cbf3d-at2g01620 1 17 unspecified role unspecified role prey prey 45 unspecified role unspecified role bait bait physical association physical association f24g16_280-cbf3d 1 45 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait physical association physical association at2g20160-cbf3d 1 45 unspecified role unspecified role prey prey 44 unspecified role unspecified role bait bait physical association physical association