MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. FEBS Lett. (0014-5793) 2003 Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no FEBS Lett. (0014-5793) 2003 Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. FEBS Lett. (0014-5793) 2003 Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no mouse-mc/9 Mus musculus mc/9 mc/9 anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no FEBS Lett. (0014-5793) 2003 Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. FEBS Lett. (0014-5793) 2003 Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no rat-rbl_2h3 Rat basophilic leukemia cell line rbl_2h3 Rat basophilic leukemia cell line anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no FEBS Lett. (0014-5793) 2003 Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. FEBS Lett. (0014-5793) 2003 Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no rat-rbl_2h3 Rat basophilic leukemia cell line rbl_2h3 Rat basophilic leukemia cell line coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no FEBS Lett. (0014-5793) 2003 Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. FEBS Lett. (0014-5793) 2003 Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no FEBS Lett. (0014-5793) 2003 Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. Targeting of MIST to Src-family kinases via SKAP55-SLAP-130 adaptor complex in mast cells. FEBS Lett. (0014-5793) 2003 Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Fujii Y., Wakahara S., Nakao T., Hara T., Ohtake H., Komurasaki T., Kitamura K., Tatsuno A., Fujiwara N., Hozumi N., Ra C., Kitamura D., Goitsuka R. no FEBS Lett. (0014-5793) 2003 clnk_mouse Cytokine-dependent hematopoietic cell linker Mast cell immunoreceptor signal transducer Clnk Mist protein protein mouse Mus musculus Mouse MTSQGNKRTTKEGFGDLRFQNVSLLKNRSWPSLSSAKGRCRAVLEPLPDHRRNLAGVPGGEKCNSNNDYEDPEFQLLKAWPSMKILPARPIQESEYADTRYFQDTMEAPLLLPPKASVSTERQTRDVRMTHLEEVDKPTFKDVRSQRFKGFKYTKINKTPLPPPRPAITLPKKYQPLPPAPPEESSAYFAPKPTFPEVQRGPRQRSAKDFSRVLGAEEESHHQTKPESSCPSSNQNTQKSPPAIASSSYMPGKHSIQARDHTGSMQHCPAQRCQAAASHSPRMLPYENTNSEKPDPTKPDEKDVWQNEWYIGEYSRQAVEDVLMKENKDGTFLVRDCSTKSKAEPYVLVVFYGNKVYNVKIRFLESNQQFALGTGLRGNEMFDSVEDIIEHYTYFPILLIDGKDKAARRKQCYLTQPLPLARLLLTQYSSQALHE Plays a role in the regulation of immunoreceptor signaling, including PLC-gamma-mediated B cell antigen receptor (BCR) signaling and FC-epsilon R1-mediated mast cell degranulation. Involved in phosphorylation of LAT mint 5CD27EC971FC0EA5 skap1_rat Src kinase-associated phosphoprotein 1 Skap1 Scap1 Skap55 Src family-associated phosphoprotein 1 Src kinase-associated phosphoprotein of 55 kDa SKAP55 adapter protein pp55 protein protein rat Rattus norvegicus (Rat) Rat MQAIALPEEICWLLEDAEDFLAEGLQNENLSPGAQDQRDHILRGFQQIKSRYCWDFQPQGDDLGQDGSDENLSGTHGPALASDASFWSDYQEEGIDDIIRGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVISRGLFLYYANEKSKQPKGTFLIKGYNVRMAPHLRKDSKKDSCFELTSQDRRSYEFTAFSPAEARDWVDQISFLLKDLSSLTIPFEEEEEEEEEDKEQEEMYNDIDGFDSARSGSQGRAMALPEPLDKEEDVYEVLPDEDDLEEDACGAHRRRVDYADYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSIIGIVPKDYLTTAFEMEGR mint Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells (By similarity). May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells 4620FC5BFD290CBD lyn_mouse Tyrosine-protein kinase Lyn Lyn V-yes-1 Yamaguchi sarcoma viral related oncogene homolog p53Lyn p56Lyn protein protein mouse Mus musculus Mouse MGCIKSKRKDNLNDDEVDSKTQPVRNTDRTIYVRDPTSNKQQRPVPEFHLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAKVNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP DIP protein P25911 original sequence version: 163 DIP protein P25911 original sequence version: 118 FDA1D21CC90C50EC fyn_mouse Tyrosine-protein kinase Fyn p59-Fyn Fyn Proto-oncogene c-Fyn protein protein mouse Mus musculus Mouse MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL 99558702596DAEE0 fyb1_mouse FYN-binding protein 1 Fyb1 Adhesion and degranulation promoting adaptor protein FYB-120/130 FYN-T-binding protein Fyb SLAP-130 SLP-76-associated phosphoprotein protein protein mouse Mus musculus Mouse MAKFNTGSNPTEEAATSSRPFKVAGQSSPSGIQSRKNLFDNQGNASPPAGPSSMPKFGTTKPPLAAKPTYEEKPEKEPKPPFLKPTGGSPRFGTQPNSVSRDPEVKVGFLKPVSPKPTSLTKEDSKPVVLRPPGNKLHNLNQESDLKTPGPKPGPAPPVPENELKPGFSKVAGAKSKFMPAAQDTDSKPRFPRHTFGQKPSLSTEDSQEENTSKNVPVQKGSPVQLGAKSKGAPFKPPKEDPEDKDHGAPSSPFPGVVLKPAASRGSPGLSKNFEEKKEDRKTDLAKNIFLNKLNQEEPARFPKAPSKLTAGTPWGQSQEKEGDKNSATPKQKALPPLSVLGPPPPKPNRPPNVDLTRFRKADSANSATKSQTPYSTTSLPPPPPTHPASQPPLPASHPAHPPVPSLPPRNIKPPLDLKHPINDENQDGVMHSDGTGNLEEEQESEGETYEDIDSSKERDKKREKEEKKRLELERKEQKEREKKEQELKKKFKLTGPIQVIHHAKACCDVKGGKNELSFKQGEDIEIIRITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKRKKNSLNAVPPRLVEDDQDVYDDVAEQDAPNSHGQSGSGGMFPPPPTDDEIYDGIEEEDDDDGSVPQVDEKTNAWSWGILKMLKGKDDRKKSIREKPKVSESDNNEGSSLPSQHKQLDVGEEVYDDVDASDFPPPPAEMSQGMSVGRAKTEEKDPKKLKKQEKEEKDLRKKFKYDGEIRVLYSTKVASSLTSKKWGARDLQIKPGESLEVIQSTDDTKVLCRNEEGKYGYVLRSYLVDNDGEIYDDIADGCIYDND DIP protein O35601 original sequence version: 105 mint Acts as an adapter protein of the FYN and LCP2 signaling cascades in T cells. Modulates the expression of interleukin-2 (IL-2). Involved in platelet activation. Prevents the degradation of SKAP1 and SKAP2 6222CC7EF1CA2BBD lck_mouse Proto-oncogene tyrosine-protein kinase LCK Lck Lsk-t Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein mouse Mus musculus Mouse MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKERPEDRPTFDYLRSVLDDFFTATEGQYQPQP 3513102F49A7FD0B skap2_mouse Src kinase-associated phosphoprotein 2 Src family-associated phosphoprotein 2 Src kinase-associated phosphoprotein 55-related protein SKAP55 homolog Src-associated adapter protein with PH and SH3 domains Pyk2/RAFTK-associated protein Skap2 Prap Saps Ra70 Scap2 Skap55r protein protein mouse Mus musculus Mouse MPNPSCTSSPGPLPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYLQEFQDKGDAEDGDEYDDPFAGPADTISLASERYDKDDDGPSDGNQFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLGSDVIPEDDEERGELYDDVDHPAAVSSPQRSQPIDDEIYEELPEEEEDTASVKMDEQGKGSRDSVHHTSGDKSTDYANFYQGLWDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYLMEMYDI B66973A656E44E05 clnk-fyb 4 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 11 protein sequence protein sequence identification protein sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1A BIOSOURCE= RBL-2H3 rat cells homomint mint clnk-lyn 6 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 9 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F3 The interaction occurs in cells coexpressing SKAP55 and SLAP-130 homomint mint clnk-skap2 6 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3 Interaction occurs in presence of SLAP-130 homomint mint clnk-fyn 2 7 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 10 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F5A BIOSOURCE= MC/9 mouse cells homomint mint lck-skap2 1 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association F5B homomint mint lck-fyb 1 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5B homomint mint fyn-fyb 1 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-8631311]The shifted ranges (148-230) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-8631311]148-230 [EBI-8631311]P39688,3 tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5B homomint mint fyn-skap2 1 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-8631352]The shifted ranges (148-230) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-8631352]148-230 [EBI-8631352]P39688,3 tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5B homomint mint lyn-skap2 1 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5B homomint mint lyn-fyb 1 11 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 physical association physical association F5B homomint mint clnk-skap1 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 protein sequence protein sequence identification protein sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F1A BIOSOURCE= RBL-2H3 rat cells homomint mint clnk-fyb-1 5 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3 homomint mint