UniProt UniProt http://www.uniprot.org Impairment of the DNA binding activity of the TATA-binding protein renders the transcriptional function of Rvb2p/Tih2p, the yeast RuvB-like protein, essential for cell growth. Impairment of the DNA binding activity of the TATA-binding protein renders the transcriptional function of Rvb2p/Tih2p, the yeast RuvB-like protein, essential for cell growth. J. Biol. Chem. (0021-9258) 2003 Ohdate H., Lim CR., Kokubo T., Matsubara K., Kimata Y., Kohno K. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ohdate H., Lim CR., Kokubo T., Matsubara K., Kimata Y., Kohno K. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2003 Impairment of the DNA binding activity of the TATA-binding protein renders the transcriptional function of Rvb2p/Tih2p, the yeast RuvB-like protein, essential for cell growth. Impairment of the DNA binding activity of the TATA-binding protein renders the transcriptional function of Rvb2p/Tih2p, the yeast RuvB-like protein, essential for cell growth. J. Biol. Chem. (0021-9258) 2003 Ohdate H., Lim CR., Kokubo T., Matsubara K., Kimata Y., Kohno K. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ohdate H., Lim CR., Kokubo T., Matsubara K., Kimata Y., Kohno K. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2003 Impairment of the DNA binding activity of the TATA-binding protein renders the transcriptional function of Rvb2p/Tih2p, the yeast RuvB-like protein, essential for cell growth. Impairment of the DNA binding activity of the TATA-binding protein renders the transcriptional function of Rvb2p/Tih2p, the yeast RuvB-like protein, essential for cell growth. J. Biol. Chem. (0021-9258) 2003 Ohdate H., Lim CR., Kokubo T., Matsubara K., Kimata Y., Kohno K. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ohdate H., Lim CR., Kokubo T., Matsubara K., Kimata Y., Kohno K. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2003 tbp_yeast TATA-box-binding protein YER148W SPT15 BTF1 TBP1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription factor D Transcription initiation factor TFIID TBP subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM 50365FFF1D3718CE 50365FFF1D3718CE ruvb1_yeast RuvB-like protein 1 RVB1 TIP49-homology protein 1 TIP49a homolog TIH1 TIP49A YDR190C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAISEVKENPGVNSSNSGAVTRTAAHTHIKGLGLDESGVAKRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKILETSANYL 93D6ECB7006AF0F2 93D6ECB7006AF0F2 ruvb2_yeast RuvB-like protein 2 TIP49-homology protein 2 TIP49b homolog RVB2 TIH2 TIP49B YPL235W P1060 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIQTSDPNETSDLKSLSLIAAHSHITGLGLDENLQPRPTSEGMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGTNYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDSARSVKYVQENESQYIDDQGNVQISIAKSADPDAMDTTE 0D8EFBA7EC711AB8 0D8EFBA7EC711AB8 tih1-tbp 3 5 unspecified role unspecified role prey prey n-terminus N-terminus HA tagged protein Tih1 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag monoclonal western monoclonal antibody western blot certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait physical association physical association tih2-tbp 3 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey c-terminus C-terminus HA tagged protein Tih2 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag monoclonal western monoclonal antibody western blot certain certain sequence position certain certain certain sequence position certain physical association physical association tih2-tbp-1 2 6 unspecified role unspecified role bait bait c-terminus C-terminus HA tagged protein Tih2 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag monoclonal western monoclonal antibody western blot certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey n-terminus N-terminus FLAG tagged protein TBP flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged monoclonal western monoclonal antibody western blot certain certain sequence position certain certain certain sequence position certain physical association physical association tih1-tbp-1 2 4 unspecified role unspecified role prey prey n-terminus N-terminus FLAG tagged protein TBP flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged monoclonal western monoclonal antibody western blot certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait n-terminus N-terminus HA tagged protein Tih1 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag monoclonal western monoclonal antibody western blot certain certain sequence position certain certain certain sequence position certain physical association physical association tih1-tbp-2 1 4 unspecified role unspecified role prey prey n-terminus N-terminus 6HIS tagged protein TBP his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein Tih1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association tih2-tbp-2 1 4 unspecified role unspecified role prey prey n-terminus N-terminus 6HIS tagged protein TBP his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role bait bait n-terminus N-terminus GST tagged protein Tih2 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association