IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of a novel prokaryotic HEAT-repeats-containing protein which interacts with a cyanobacterial IscA homolog. Identification of a novel prokaryotic HEAT-repeats-containing protein which interacts with a cyanobacterial IscA homolog. FEBS Lett. (0014-5793) 2002 Morimoto K., Nishio K., Nakai M. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Gel filtration fractions containing the IscA proteins of cyanobacterial lysate were used for chemical cross-linking experiments with disuccinimidyl suberate (DSS) or bis-(sulfosuccinimidyl)-suberate (BS3). fig 2 nakai@protein.osaka-u.ac.jp syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Morimoto K., Nishio K., Nakai M. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Gel filtration fractions containing the IscA proteins of cyanobacterial lysate were used for chemical cross-linking experiments with disuccinimidyl suberate (DSS) or bis-(sulfosuccinimidyl)-suberate (BS3). fig 2 nakai@protein.osaka-u.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. FEBS Lett. (0014-5793) 2002 Identification of a novel prokaryotic HEAT-repeats-containing protein which interacts with a cyanobacterial IscA homolog. Identification of a novel prokaryotic HEAT-repeats-containing protein which interacts with a cyanobacterial IscA homolog. FEBS Lett. (0014-5793) 2002 Morimoto K., Nishio K., Nakai M. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Gel filtration fractions containing the IscA proteins of cyanobacterial lysate were used for chemical cross-linking experiments with disuccinimidyl suberate (DSS) or bis-(sulfosuccinimidyl)-suberate (BS3). fig 2 nakai@protein.osaka-u.ac.jp syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) anti bait coip anti bait coimmunoprecipitation anti bait coip partial id prot seq partial identification of protein sequence partial id prot seq Morimoto K., Nishio K., Nakai M. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Gel filtration fractions containing the IscA proteins of cyanobacterial lysate were used for chemical cross-linking experiments with disuccinimidyl suberate (DSS) or bis-(sulfosuccinimidyl)-suberate (BS3). fig 2 nakai@protein.osaka-u.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. FEBS Lett. (0014-5793) 2002 Identification of a novel prokaryotic HEAT-repeats-containing protein which interacts with a cyanobacterial IscA homolog. Identification of a novel prokaryotic HEAT-repeats-containing protein which interacts with a cyanobacterial IscA homolog. FEBS Lett. (0014-5793) 2002 Morimoto K., Nishio K., Nakai M. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Gel filtration fractions containing the IscA proteins of cyanobacterial lysate were used for chemical cross-linking experiments with disuccinimidyl suberate (DSS) or bis-(sulfosuccinimidyl)-suberate (BS3). fig 2 nakai@protein.osaka-u.ac.jp ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Morimoto K., Nishio K., Nakai M. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Gel filtration fractions containing the IscA proteins of cyanobacterial lysate were used for chemical cross-linking experiments with disuccinimidyl suberate (DSS) or bis-(sulfosuccinimidyl)-suberate (BS3). fig 2 nakai@protein.osaka-u.ac.jp Annotation to indicate that this entry has been checked and accepted by a senior curator. FEBS Lett. (0014-5793) 2002 p72742_syny3 slr1098 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MRKYGAMRNQDDLLLEDSWVDPLDQLDDDVAPPPPDPDEMLVLLTSREAPQRMLAARAFCEIADRRAVEPLINLLGDSCPLVRVSAAYALGRNTDPTIVEPLIQSLQTDFNGYVRKGLVWALGNCGDRRALAPLIHALKTDISAVRLWSASSLPNIAKLAYEDVIATIPPLIEGLRRDKMAAVRSNCAWAVGQLCRELPSNVVYATAIDALLEALVEDEDFGVKEDAKSALLRLGDARGLQMIEDLEMDGLI 0A56156F26103E2B y1417_syny3 Uncharacterized protein slr1417 slr1417 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MSQATATQAKGIQLSDAALKHLLALKEQQGKDLCLRVGVRQGGCSGMSYMMDFEEPNRATEHDEVFDYEGFQIICDRKSLLYLYGLMLDYSNALIGGGFQFTNPNANQTCGCGKSFGV 098CA7FB4317B5A3 y1565_syny3 Uncharacterized protein slr1565 slr1565 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MLQLTPSAAQEIKRLQHSRQLTRHHFRLAVRPGGCAGWLYHLDFVPEITADDLEYESGGVTVLVDSQSAGYLHNLKLDYAEDLMGGGFRFTNPNAAQVCSCSLSFAPNLEKNL 81189FAECEC39307 isca1-isca1-1 1 5 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association iaih-isca2-3 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association iaih-isca2-4 3 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait direct interaction direct interaction