IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. Plant Cell (1040-4651) 2001 Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 Plant Cell (1040-4651) 2001 Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. Plant Cell (1040-4651) 2001 Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 Plant Cell (1040-4651) 2001 Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. Plant Cell (1040-4651) 2001 Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 chlre Chlamydomonas reinhardtii Chlamydomonas smithii anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 Plant Cell (1040-4651) 2001 Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. Functional studies of Ycf3: its role in assembly of photosystem I and interactions with some of its subunits. Plant Cell (1040-4651) 2001 Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 chlre Chlamydomonas reinhardtii Chlamydomonas smithii biochemical biochemical western blot western blot Immuno blot Immuno blot Naver H., Boudreau E., Rochaix JD. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species find out more experimental details Solubilized Chlamydomonas reinhardtii thylakoid membranes were used for immunoprecipitation. fig 8, 9 Plant Cell (1040-4651) 2001 psaf_chlre Photosystem I reaction center subunit III, chloroplastic Light-harvesting complex I 17 kDa protein PSI-F P21 protein PSAF protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MALTMRNPAVKASSRVAPSSRRALRVACQAQKNETASKVGTALAASALAAAVSLSAPSAAMADIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTKARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGYIGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQRGTLLEKEENITVSPR DIP protein P12356 original sequence version: 58 DFF1C7B8EC8CB536 psag_chlre Photosystem I reaction center subunit V, chloroplastic PSI-G Light-harvesting complex I 10 kDa protein P35 protein PSAG protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MQTLASRPSLRASARVAPRRAPRVAVVTKAALDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQGANLS 0F2EBD902ABD5689 psac_chlre Photosystem I iron-sulfur center Photosystem I subunit VII 9 kDa polypeptide PSI-C PsaC psaC protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MAHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSY 6EE84943D2E3E102 psab_chlre Photosystem I P700 chlorophyll a apoprotein A2 PsaB PSI-B psaB ps1a2 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MATKLFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVTDPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRFG 82F9914CE07A7908 psad_chlre Photosystem I reaction center subunit II, chloroplastic Photosystem I 20 kDa subunit psaD protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MAVMMRTQAPAATRASSRVAVAARPAARRAVVVRAEAEAAPAAAKKAAEKPAWTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMMSPAEI 3A30F8527A896FC6 psae_chlre Photosystem I reaction center subunit IV, chloroplastic Photosystem I 8.1 kDa protein P30 protein PSAE protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MQALSSRVNIAAKPQRAQRLVVRAEEVKAAPKKEVGPKRGSLVKILRPESYWFNQVGKVVSVDQSGVRYPVVVRFENQNYAGVTTNNYALDEVVAAK 3FA1DE3B3C27A7AD psaa_chlre Photosystem I P700 chlorophyll a apoprotein A1 psaA ps1a1 PSI-A PsaA protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MTISTPEREAKKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG DIP protein P12154 original sequence version: 118 DIP protein P12154 original sequence version: 94 DIP protein P12154 original sequence version: 93 4D8876D1094BDCD3 ycf3_chlre Photosystem I assembly protein Ycf3 ycf3 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MPRTQRNDNFIDKTFTVVADILLKVLPTSQREKQAFSYYRNGMSAQAEGEYAEALQNYYEAMRLEVDAYDRSYILYNIGLIHTSNGEHGRALEYYYQALERNPSLSSALNNIAVIYHYRGEQAIENGQSEISQILFEKAADYWKEAIRLAPTNYIEALNWLKMTGRLTGLAT B91D933BDDC2363B psaa-psae-1 1 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association psab-psac-1 1 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association psac-psad-1 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association psad-psac-1 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association psae-psaf-1 1 10 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association psaf-psad-1 1 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association ycf3-psaa-1 1 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Ycf3 may interact directly only with the PSI subunits, psaA and psaD as shown in other experiments. Ycf3 is necessary for PSI assembly but is not found in the final PSI complex. psaa-ycf3-1 1 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association psad-ycf3-1 1 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association psaa-ycf3-2 2 12 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role prey prey physical association physical association psac-psad-2 3 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association psad-psac-2 3 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association psae-psad-2 3 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association ycf3-psaa-2 3 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Ycf3 is necessary for PSI assembly but is not found in the final PSI complex. psaa-psaf-1 4 6 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association