IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Mol. Cell. Biol. (0270-7306) 2001 Tan I., Seow KT., Lim L., Leung T. Dimer/tetramer formation identified by molecular weight determination 2A mcbthoml@imcb.nus.edu.sg chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Tan I., Seow KT., Lim L., Leung T. Dimer/tetramer formation identified by molecular weight determination 2A mcbthoml@imcb.nus.edu.sg Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 2001 Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Mol. Cell. Biol. (0270-7306) 2001 Tan I., Seow KT., Lim L., Leung T. Dimer/tetramer formation identified by molecular weight determination 2A mcbthoml@imcb.nus.edu.sg in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Tan I., Seow KT., Lim L., Leung T. Dimer/tetramer formation identified by molecular weight determination 2A mcbthoml@imcb.nus.edu.sg Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 2001 Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Mol. Cell. Biol. (0270-7306) 2001 Tan I., Seow KT., Lim L., Leung T. Dimer/tetramer formation identified by molecular weight determination 2A mcbthoml@imcb.nus.edu.sg rat-brain Rattus norvegicus brain brain Brain [cerebrum] molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column monoclonal western monoclonal antibody western blot monoclonal western Tan I., Seow KT., Lim L., Leung T. Dimer/tetramer formation identified by molecular weight determination 2A mcbthoml@imcb.nus.edu.sg Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 2001 Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Mol. Cell. Biol. (0270-7306) 2001 Tan I., Seow KT., Lim L., Leung T. Dimer/tetramer formation identified by molecular weight determination 2A mcbthoml@imcb.nus.edu.sg chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 crosslink cross-linking study crosslink monoclonal western monoclonal antibody western blot monoclonal western Tan I., Seow KT., Lim L., Leung T. Dimer/tetramer formation identified by molecular weight determination 2A mcbthoml@imcb.nus.edu.sg Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 2001 ml12a_human Myosin regulatory light chain 12A MYL12A RLC MLCB Myosin regulatory light chain 2, nonsarcomeric Myosin RLC MLC-2B MRLC3 Myosin regulatory light chain MRLC3 Epididymis secretory protein Li 24 protein protein human Homo sapiens Human MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD C871AA881BF5C215 mrcka CDC42BPA from African green monkey protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt mrcka_rat Serine/threonine-protein kinase MRCK alpha Myotonic dystrophy kinase-related CDC42-binding kinase alpha Cdc42bpa Pk428 CDC42-binding protein kinase alpha protein protein rat Rattus norvegicus (Rat) Rat MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDSKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEEMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPTQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELTRKLQESTQTVQALQYSTVDGPLTASKDLEIKSLKEEIEKLRKQVAEVNHLEQQLEEANSVRRELDDAFRQIKAFEKQIKTLQQEREELNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKAESLRQELRRAERAKKELEVHTEALIAEASKDRKLREQSRHYSKQLENELEGLKQKQISYSPGICSIEHQQEITKLKTDLEKKSIFYEEEISKREGIHASEIKNLKKELHDSEGQQLALNKEIMVLKDKLEKTRRESQSEREEFENEFKQQYEREKVLLTEENKKLTSELDKLTSLYESLSLRNQHLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGVEHRDSQHSFLAFLNTPTDALDQFERSPSCTPAGKGRRIADSAPLPVHTPTLRKKGCPASAGFPPKRKTHQFFVKSFTAPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKGVGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYDIAEGKASQPSSVISQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSAPSDKCSILMLADSETERSKWVGVLSELHKVLKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERVALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPSDQLVAVISGRNRHVRLFPMSALDGRETDFYKLAETKGCQTIAAGKVRHGALSCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPCNVQWMAIFSEHLCVGFQSGFLRYPLNGEGSPCNMLHSNDHTLAFITHQPMDAICAVEISNKEYLLCFSSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSIYSENAVDIFDVNSMEWIQTLPLKKVRPLNTEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYNTKRQPMPSPSEGSLSSGGVDQGSDAPVRDYDGEDSDSPRHSTASNSSNLSSPPSPVSPRKTKSLSLESTDRGSWDP 65F62F7872ACCD3B mrcka_human Serine/threonine-protein kinase MRCK alpha CDC42BPA KIAA0451 Myotonic dystrophy kinase-related CDC42-binding kinase alpha DMPK-like alpha CDC42-binding protein kinase alpha protein protein human Homo sapiens Human MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFERSPSCTPASKGRRTVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVISQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSGKVRHGALTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGNPYSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNNEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSDAPARDFDGEDSDSPRHSTASNSSNLSSPPSPASPRKTKSLSLESTDRGSWDP 48B10F81B5405A0A cdc42bpa-cdc42bpa-1 3 7 unspecified role unspecified role neutral component neutral component direct interaction direct interaction cdc42bpa-cdc42bpa-2 3 7 unspecified role unspecified role neutral component neutral component direct interaction direct interaction cdc42bpa-cd42bpa-1 4 8 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Stoichiometry unknown but multiple cdc42bpa-cd42bpa-2 4 6 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Stoichiometry unknown but multiple cdc42bpa-cd42bpa-3 1 8 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 20 24 direct interaction direct interaction cdc42bpa-cd42bpa-4 1 8 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range coiled-coil 1 region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain coiled-coil 2 region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range coiled-coil 1 region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain coiled-coil 2 region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 28 32 29 33 direct interaction direct interaction cdc42bpa-cd42bpa-5 4 8 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Stoichiometry unknown but multiple cdc42bpa-cd42bpa-6 1 8 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Molecular weight suggests product to be a homodimer N-terminal homodimerization is required for enzyme autoactivation cdc42bpa-cd42bpa-7 4 8 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Molecular weight suggests product to be a homodimer cdc42bpa-mlcb-1 2 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 enzyme enzyme unspecified role unspecified role n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5VT25:p.Ser234Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:52:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser234ala' Tue Jun 30 17:33:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser234Ala' Q5VT25:p.Lys106Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:43:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys106ala' Tue Jun 30 17:46:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys106Ala' Q5VT25:p.Thr240Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:35:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr240ala' Tue Jun 30 17:51:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr240Ala' Q5VT25:p.Thr403Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:33:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr403ala' Tue Jun 30 19:50:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr403Ala' chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphorylation phosphorylation reaction phosphorylation Previous experiments have shown this construct of CDC42BPA to dimerize, and that this required for enzyme activity. A transphosphorylation event is required within the dimer for activation to occur. cdc42bpa-cd42bpa-9 1 8 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range coiled-coil 2_3 binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 64 62 direct interaction direct interaction Coiled-coil region will only interact with inactive kinase domain. This interaction prevents kinase domain from phosphorylating MRCL3 (MLC2) cdc42bpa-cdc42bpa-8 2 8 self self unspecified role unspecified role region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5VT25:p.Lys106Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:03:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys106ala' Tue Jun 30 19:00:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys106Ala' Q5VT25:p.Ser234Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:27:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser234ala' Tue Jun 30 17:03:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser234Ala' Q5VT25:p.Thr240Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:45:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr240ala' Tue Jun 30 20:23:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr240Ala' Q5VT25:p.Thr403Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:46:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr403ala' Tue Jun 30 19:12:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr403Ala' n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphorylation phosphorylation reaction phosphorylation Previous experiments have shown this construct of CDC42BPA to dimerize, and that this required for enzyme activity. A transphosphorylation event is required within the dimer for activation to occur.